LXL04_025063 | RubberDandelionOmics

Gene overview

LXL04_025063

Reference: OH-1004 Chr: Chr05 Coordinates: 105042442-105048095 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3063 bp · LXL04_025063|LXL04_025063|OH1004|cDNA

ATGTTTGGGGAATGGGGATTAAATTTCGGAAGTCAAGAACTTGCCAATGCCCACTGTCGTAGGCTTGCAGCTCCTCCTCACCGCACAGGAGGTCGTCGGCCGTCGCACAGCACCAGGACTCCAGGAGCCGTCGTTCGTCGCACAACAGTTCGTGTCCCGGATTGCTGGAGTAGTTATCAGTGTATGCCATCGTTATCCTTCGAAATAAATCTGAAATTTTGTTTAAGTGAAAGATGCTTGGTACATGTAAGTATTTTTCA...

CDS

Download CDS FASTA

3063 bp · LXL04_025063|LXL04_025063|OH1004|CDS

ATGTTTGGGGAATGGGGATTAAATTTCGGAAGTCAAGAACTTGCCAATGCCCACTGTCGTAGGCTTGCAGCTCCTCCTCACCGCACAGGAGGTCGTCGGCCGTCGCACAGCACCAGGACTCCAGGAGCCGTCGTTCGTCGCACAACAGTTCGTGTCCCGGATTGCTGGAGTAGTTATCAGTGTATGCCATCGTTATCCTTCGAAATAAATCTGAAATTTTGTTTAAGTGAAAGATGCTTGGTACATGTAAGTATTTTTCA...

Protein

Download Protein FASTA

1020 aa · LXL04_025063|LXL04_025063|OH1004|PROTEIN

MFGEWGLNFGSQELANAHCRRLAAPPHRTGGRRPSHSTRTPGAVVRRTTVRVPDCWSSYQCMPSLSFEINLKFCLSERCLVHVSIFQAARGYRHVLGRKMRLNGLLLCNISRYFSTSKHKLKENVFNKLDSYDRSSRFSKVSATMYQDSFDEVIDEEKHDFDASLVRKQFPFIILGKSKPVELYDGSPDSHEKSNIFTAETYTDSWDPLANEFNDHSSYKIESISDQSSLDSTCPPSIFDNSSKEENSSTLPSYDKSPYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025063`
TK1151 ID	TkA06G083890
OH-1004 ID	LXL04_025063
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 94.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025063

Location Chr05:105042442-105048095 (-)

Description Similar to RECG: ATP-dependent DNA helicase homolog RECG, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01440`	Plays a critical role in recombination and DNA repair.	The RECG1 DNA Translocase Is a Key Factor in Recombination Surveillance, Repair, and Segregation of the Mitochondrial DNA in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00680

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025063 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0071932 replication fork reversal Biological Process

GO:1905951 mitochondrion DNA recombination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009295 nucleoid Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000400 four-way junction DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003678 DNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G01440

bsu:BSU15870

spn:SP_1697

syn:slr0020

tma:TM0205

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.549

Rank 1 · LXL04_025063 · OH-1004

Mitochondrion0.433

Rank 2 · LXL04_025063 · OH-1004

Nucleus0.064

Rank 3 · LXL04_025063 · OH-1004

Cytoplasm0.046

Rank 4 · LXL04_025063 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_025063 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04851.22ResIII571-754 aa

PF00270.36DEAD593-758 aa

PF00271.38Helicase_C796-913 aa

PF19833.5RecG_dom3_C940-997 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025063	`PF04851.22`	ResIII	571	754	5.6e-08	33.6
LXL04_025063	`PF00270.36`	DEAD	593	758	7.1e-17	62.4
LXL04_025063	`PF00271.38`	Helicase_C	796	913	1.8e-20	73.9
LXL04_025063	`PF19833.5`	RecG_dom3_C	940	997	1.4e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4INA9`	Arabidopsis thaliana	ATP-dependent DNA helicase homolog RECG1, chloroplastic/mitochondrial	59.836%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card