LXL04_025040 | RubberDandelionOmics

Gene overview

LXL04_025040

Reference: OH-1004 Chr: Chr05 Coordinates: 104475407-104476097 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_025040|LXL04_025040|OH1004|cDNA

ATGTCTTTAATTTCCAGGCTTTTGACTCCGCCCCTGTTTCTCTGGAGCTTCATATCATTATCCCTGTTCTCATCGGCTTCGCTGGTTCAATCTCCGGCGGGATCTCGAGGGCTCCAACGTCGCGCAATTAGAAGTGGTGGAAATCAGCCTGATTTCGTGGTTGATTTGAACGTCACTAACTTCGATGCAGTACTCAAGGACACCTCCGCTCCTTTCGCCGTTGTGGAGTTCTTCGCTCACGGAAGCCGTTGCAGAGTGTA...

CDS

Download CDS FASTA

504 bp · LXL04_025040|LXL04_025040|OH1004|CDS

ATGTCTTTAATTTCCAGGCTTTTGACTCCGCCCCTGTTTCTCTGGAGCTTCATATCATTATCCCTGTTCTCATCGGCTTCGCTGGTTCAATCTCCGGCGGGATCTCGAGGGCTCCAACGTCGCGCAATTAGAAGTGGTGGAAATCAGCCTGATTTCGTGGTTGATTTGAACGTCACTAACTTCGATGCAGTACTCAAGGACACCTCCGCTCCTTTCGCCGTTGTGGAGTTCTTCGCTCACGGAAGCCGTTGCAGAGTGTA...

Protein

Download Protein FASTA

167 aa · LXL04_025040|LXL04_025040|OH1004|PROTEIN

MSLISRLLTPPLFLWSFISLSLFSSASLVQSPAGSRGLQRRAIRSGGNQPDFVVDLNVTNFDAVLKDTSAPFAVVEFFAHGSRCRVYTSQYGKVARLFNGVNAVHPGIILVTRVDCAYKVNTKLCDKFNISDHPSLFWGPSSRFVGGSWDGKNEKSEIRYLNGLIHN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025040`
TK1151 ID	TkA06G085980
OH-1004 ID	LXL04_025040
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 82.990 / OH-1004 96.407 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025040

Location Chr05:104475407-104476097 (+)

Description Similar to QSOX2: Sulfhydryl oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01270`	Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide.	No verified direct reference in this release
`At1g15020`	Sulfhydryl oxidase involved in the regulation of cation homeostasis.	An Arabidopsis quiescin-sulfhydryl oxidase regulates cation homeostasis at the root symplast-xylem interface.2007 · DOI: 10.1038/sj.emboj.7601757

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0552500`	Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025040 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0043157 response to cation stress Biological Process

GO:0043268 positive regulation of potassium ion transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0003756 protein disulfide isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15020

ath:AT2G01270

dosa:Os05g0552500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.296

Rank 1 · LXL04_025040 · OH-1004

Golgi apparatus0.221

Rank 2 · LXL04_025040 · OH-1004

Lysosome / Vacuole0.167

Rank 3 · LXL04_025040 · OH-1004

Cytoplasm0.128

Rank 4 · LXL04_025040 · OH-1004

Extracellular0.126

Rank 5 · LXL04_025040 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU40`	Arabidopsis thaliana	Sulfhydryl oxidase 2	57.639%	Swiss-Prot	strong database homology
`Q8W4J3`	Arabidopsis thaliana	Sulfhydryl oxidase 1	55.385%	Swiss-Prot	strong database homology
`Q6AUC6`	Oryza sativa subsp. japonica	Sulfhydryl oxidase 1	52.542%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card