LXL04_025037 | RubberDandelionOmics

Gene overview

LXL04_025037

Reference: OH-1004 Chr: Chr05 Coordinates: 104470277-104471758 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_025037|LXL04_025037|OH1004|cDNA

ATGGGGGATCATTTCGTGTTTTTGGTCGATCGATTACTCACTGAATCAACATTAGAGGCTGCAATCGAAAGCAGAAACCCTAAAAAGCAGTTGGATCCCTTGGGAAAAGACGACACAGTTATTGATTGTTCATCTTCTTCTAACGTTGACTTCACTCCAAAGAAATTGGTTGAATGTAGGATATGTCAAGATGAGGATTTTGATTGCAATATGGAGACCCCATGCTCTTGTTGTGGCAGCTTGAAGTATGCTCATCGCAG...

CDS

Download CDS FASTA

825 bp · LXL04_025037|LXL04_025037|OH1004|CDS

ATGGGGGATCATTTCGTGTTTTTGGTCGATCGATTACTCACTGAATCAACATTAGAGGCTGCAATCGAAAGCAGAAACCCTAAAAAGCAGTTGGATCCCTTGGGAAAAGACGACACAGTTATTGATTGTTCATCTTCTTCTAACGTTGACTTCACTCCAAAGAAATTGGTTGAATGTAGGATATGTCAAGATGAGGATTTTGATTGCAATATGGAGACCCCATGCTCTTGTTGTGGCAGCTTGAAGTATGCTCATCGCAG...

Protein

Download Protein FASTA

274 aa · LXL04_025037|LXL04_025037|OH1004|PROTEIN

MGDHFVFLVDRLLTESTLEAAIESRNPKKQLDPLGKDDTVIDCSSSSNVDFTPKKLVECRICQDEDFDCNMETPCSCCGSLKYAHRRCVQRWCNEKGDTMCEICHQQFKPGYTAPSRIFRLGGIPLNLRGHWHIARRDTITNNNPQLITVVSRDRSFLNQEYDEYADPTSRSFTCFRSVAAIFVVLLFLRHSLPAIVNGTWNYSFPMFMLWFIRTSAIVVPIYIMMRAMAALIHWRRRLAWNASTSPLSSSDDDDEGEGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025037`
TK1151 ID	TkA06G086050
OH-1004 ID	LXL04_025037
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025037

Location Chr05:104470277-104471758 (+)

Description Similar to SUD1: Probable E3 ubiquitin ligase SUD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34100`	Probable E3 ubiquitin ligase acting as a positive post-transcriptional regulator of 3-hydroxy-3-methylglutaryl-coenzyme A reductase activity.	Arabidopsis ECERIFERUM9 involvement in cuticle formation and maintenance of plant water status.2012 · DOI: 10.1104/pp.112.198697 The SUD1 gene encodes a putative E3 ubiquitin ligase and is a positive regulator of 3-hydroxy-3-methylglutaryl coenzyme a reductase activity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108696

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025037 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0044790 suppression of viral release by host Biological Process

GO:0140367 antibacterial innate immune response Biological Process

GO:0140374 antiviral innate immune response Biological Process

KEGG gene cross-reference

ath:AT4G34100

bta:508949

dre:100000640

dre:555611

rno:362849

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.292

Rank 1 · LXL04_025037 · OH-1004

Lysosome / Vacuole0.282

Rank 2 · LXL04_025037 · OH-1004

Endoplasmic reticulum0.214

Rank 3 · LXL04_025037 · OH-1004

Cytoplasm0.193

Rank 4 · LXL04_025037 · OH-1004

Nucleus0.154

Rank 5 · LXL04_025037 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12906.14RINGv59-104 aa

PF12428.14DUF3675110-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025037	`PF12906.14`	RINGv	59	104	2.4e-10	41.1
LXL04_025037	`PF12428.14`	DUF3675	110	229	1.7e-36	126.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JKK0`	Arabidopsis thaliana	Probable E3 ubiquitin ligase SUD1	35.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card