LXL04_025010 | RubberDandelionOmics

Gene overview

LXL04_025010

Reference: OH-1004 Chr: Chr05 Coordinates: 104038086-104038930 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · LXL04_025010|LXL04_025010|OH1004|cDNA

ATGGCCTCATACTCATCCTCAAGCTACCTTCTCAACCACGTTGATCTGCCTTCACTCTACTATCAAACCAGCAATGAAAATGGTGGTATTATTGACTTGGGGCTTAGTCTTAGAGTTTTGCAGCCAGAAAATCCCCATGATGACTATCACAATCTGGTAGAATGGAATCAGTTACACCCTTTTGAAAGTCCAAATGTTGGTGTCACCGAAAGAAACGCATTCCAAAGAGGAGTGCAACAAAGCGATTTTGTGAAGGTTAA...

CDS

Download CDS FASTA

543 bp · LXL04_025010|LXL04_025010|OH1004|CDS

ATGGCCTCATACTCATCCTCAAGCTACCTTCTCAACCACGTTGATCTGCCTTCACTCTACTATCAAACCAGCAATGAAAATGGTGGTATTATTGACTTGGGGCTTAGTCTTAGAGTTTTGCAGCCAGAAAATCCCCATGATGACTATCACAATCTGGTAGAATGGAATCAGTTACACCCTTTTGAAAGTCCAAATGTTGGTGTCACCGAAAGAAACGCATTCCAAAGAGGAGTGCAACAAAGCGATTTTGTGAAGGTTAA...

Protein

Download Protein FASTA

180 aa · LXL04_025010|LXL04_025010|OH1004|PROTEIN

MASYSSSSYLLNHVDLPSLYYQTSNENGGIIDLGLSLRVLQPENPHDDYHNLVEWNQLHPFESPNVGVTERNAFQRGVQQSDFVKVNMDGVLVGRKISVIDHSSYSSLATQLEDMFGKQCLSGLRLFESGSEFSLWYKDRDEQWRVVGDVPWKEFVDTVKRIRIMLMKDETLIQFTSTLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025010`
TK1151 ID	TkA06G087920
OH-1004 ID	LXL04_025010
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 98.876 / OH-1004 97.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025010

Location Chr05:104038086-104038930 (-)

Description Similar to IAA32: Auxin-responsive protein IAA32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01200`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At1g15050`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At2g33310`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At1g04550`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XB18`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025010 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G04550

ath:AT1G15050

ath:AT2G01200

ath:AT2G33310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.715

Rank 1 · LXL04_025010 · OH-1004

Cytoplasm0.335

Rank 2 · LXL04_025010 · OH-1004

Cell membrane0.090

Rank 3 · LXL04_025010 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_025010 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_025010 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309.23AUX_IAA75-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025010	`PF02309.23`	AUX_IAA	75	170	1.8e-24	87.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RYC6`	Arabidopsis thaliana	Auxin-responsive protein IAA32	45.349%	Swiss-Prot	moderate database homology
`Q9C5X0`	Arabidopsis thaliana	Auxin-responsive protein IAA34	46.753%	Swiss-Prot	moderate database homology
`Q38831`	Arabidopsis thaliana	Auxin-responsive protein IAA13	47.475%	Swiss-Prot	weak database homology
`Q38830`	Arabidopsis thaliana	Auxin-responsive protein IAA12	50.526%	Swiss-Prot	weak database homology
`A2XB18`	Oryza sativa subsp. indica	Auxin-responsive protein IAA10	47.423%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card