LXL04_024988 | RubberDandelionOmics

Gene overview

LXL04_024988

Reference: OH-1004 Chr: Chr05 Coordinates: 103564727-103569565 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3315 bp · LXL04_024988|LXL04_024988|OH1004|cDNA

ATGGATTCTCCAAAAACAATATTACGTAAAGATTCTGTCCTAATTACCTGCTTTAACAATGGGTTTTCTTTCTGCACCATTGAGACCTCTCTGCACTTAAGTCACTTCATCCATTTTAGAAGAAAACTGGCGAGCTGTGTTTTCATGGCCCAAAAACAAACAAACGTCGAGAATGGGTGGCTTTATACACCTTTGCAAGCTATTCCACCATCGGAAACAAACGAATATGTTACTCCAATGGTTAGAGCAGGAACGTTAAG...

CDS

Download CDS FASTA

3315 bp · LXL04_024988|LXL04_024988|OH1004|CDS

ATGGATTCTCCAAAAACAATATTACGTAAAGATTCTGTCCTAATTACCTGCTTTAACAATGGGTTTTCTTTCTGCACCATTGAGACCTCTCTGCACTTAAGTCACTTCATCCATTTTAGAAGAAAACTGGCGAGCTGTGTTTTCATGGCCCAAAAACAAACAAACGTCGAGAATGGGTGGCTTTATACACCTTTGCAAGCTATTCCACCATCGGAAACAAACGAATATGTTACTCCAATGGTTAGAGCAGGAACGTTAAG...

Protein

Download Protein FASTA

1104 aa · LXL04_024988|LXL04_024988|OH1004|PROTEIN

MDSPKTILRKDSVLITCFNNGFSFCTIETSLHLSHFIHFRRKLASCVFMAQKQTNVENGWLYTPLQAIPPSETNEYVTPMVRAGTLSKLTFWWLNPLMIKGKSKVLDNKDIPKLRKQDTAEECYSRFMETMNNRRGSDSSPSILSTLFVWQWKQIVITGLFALIKVLTLASGPLILRAFITVFQGKQSFKHEGYFLALGLFMAKCFESVSERQLKFGSRVIGLQVKSMLCAAIYQKQLRLSNDAKLSYSSGQILNYATVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024988`
TK1151 ID	TkA06G090400
OH-1004 ID	LXL04_024988
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	60.200
Protein coverage (%)	TK1151 99.664 / OH-1004 80.978 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024988

Location Chr05:103564727-103569565 (-)

Description Similar to ABCC10: ABC transporter C family member 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59140`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At1g04120`	Pump for glutathione S-conjugates.	The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875 The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045 The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0142800`	ABC transporter that may affect phytic acid transport and compartmentalization.	Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1
`UniProt: A2XCD4`	ABC transporter that may affect phytic acid transport and compartmentalization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008281 sulfonylurea receptor activity Molecular Function

GO:0008559 ABC-type xenobiotic transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G04120

ath:AT3G59140

dosa:Os03g0142800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.341

Rank 1 · LXL04_024988 · OH-1004

Cell membrane0.261

Rank 2 · LXL04_024988 · OH-1004

Lysosome / Vacuole0.197

Rank 3 · LXL04_024988 · OH-1004

Cytoplasm0.132

Rank 4 · LXL04_024988 · OH-1004

Golgi apparatus0.092

Rank 5 · LXL04_024988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane156-423 aa

PF00005.34ABC_tran487-573 aa

PF14223.15Retrotran_gag_2626-740 aa

PF00098.29zf-CCHC816-832 aa

PF00005.34ABC_tran857-895 aa

PF00664.29ABC_membrane1010-1096 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024988	`PF00664.29`	ABC_membrane	156	423	3.6e-28	99.8
LXL04_024988	`PF00005.34`	ABC_tran	487	573	3.2e-22	80.3
LXL04_024988	`PF14223.15`	Retrotran_gag_2	626	740	1.6e-10	41.7
LXL04_024988	`PF00098.29`	zf-CCHC	816	832	5.2e-06	27.0
LXL04_024988	`PF00005.34`	ABC_tran	857	895	3.2e-22	80.3
LXL04_024988	`PF00664.29`	ABC_membrane	1010	1096	3.6e-28	99.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYS2`	Arabidopsis thaliana	ABC transporter C family member 10	49.434%	Swiss-Prot	weak database homology
`Q7GB25`	Arabidopsis thaliana	ABC transporter C family member 5	40.392%	Swiss-Prot	weak database homology
`Q10RX7`	Oryza sativa subsp. japonica	ABC transporter C family member 13	41.502%	Swiss-Prot	weak database homology
`A2XCD4`	Oryza sativa subsp. indica	ABC transporter C family member 13	41.502%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card