Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1645 bp · LXL04_024987|LXL04_024987|OH1004|cDNA
ATGGCGACATACAAGCTCGCAGCGATCATCAGAAACTCTACCAATAACGACGAATTCCTTCTCGTTAAGCAAACTCCGCCCCCCAAATACGATGACCAAGAATACGACTCGTTTGCTGACTCCACACTCTGGGACTTGCCGTCAGCGAAATTGACCTCGCTATCACCGGAATCAGATTCATCTACTCAACTCGTACTGCAAGGTGAAGAATCGTGTTTGCATAAGCTCAATTTCAGGAAATTTGATCTTCTTTCAGCTCT...
1482 bp · LXL04_024987|LXL04_024987|OH1004|CDS
ATGGCGACATACAAGCTCGCAGCGATCATCAGAAACTCTACCAATAACGACGAATTCCTTCTCGTTAAGCAAACTCCGCCCCCCAAATACGATGACCAAGAATACGACTCGTTTGCTGACTCCACACTCTGGGACTTGCCGTCAGCGAAATTGACCTCGCTATCACCGGAATCAGATTCATCTACTCAACTCGTACTGCAAGGTGAAGAATCGTGTTTGCATAAGCTCAATTTCAGGAAATTTGATCTTCTTTCAGCTCT...
Protein
Download Protein FASTA493 aa · LXL04_024987|LXL04_024987|OH1004|PROTEIN
MATYKLAAIIRNSTNNDEFLLVKQTPPPKYDDQEYDSFADSTLWDLPSAKLTSLSPESDSSTQLVLQGEESCLHKLNFRKFDLLSALAEVLGQVGLESVTGVDWKFLKYVEEPNFGPGFPIQTVYVTADLVLNNLKDTCQWSSIEICSNMLVQVKPGNDRVGPLVVNGQLNNSIQSDSLKLPPTLSCQEYPPGVNIVPMGSKTQRPFHTTNIIVFSSRNNHDKYETSHFVAQGDAMIVDPGCRSEFNKELAEIVAALPRK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_024987 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_024987 |
|---|---|
| Location | Chr05:103556900-103559968 (+) |
| Description | Similar to lactb2: Endoribonuclease LACTB2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0031123 RNA 3'-end processing Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0003727 single-stranded RNA binding Molecular Function GO:0004521 RNA endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | bta:535021 dme:Dmel_CG12375 rno:297768 xla:495268 xtr:779879 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00753.34Lactamase_B230-351 aaPF17778.8WHD_BLACT425-461 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_024987 | PF00753.34 | Lactamase_B | 230 | 351 | 4.6e-08 | 34.0 |
| LXL04_024987 | PF17778.8 | WHD_BLACT | 425 | 461 | 5.7e-06 | 26.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.