LXL04_024941 | RubberDandelionOmics

Gene overview

LXL04_024941

Reference: OH-1004 Chr: Chr05 Coordinates: 102505826-102508360 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · LXL04_024941|LXL04_024941|OH1004|cDNA

ATGCTACATATATATGTACCCACAATTTCAGCAGTTCCTACTTACTCCCAAACTCCTATTTGGGACTTTGGGTCATCTTGTTACCAAATGGCTTTCTGTAATCCCCCCACCCTTTTACCTTCATTGTCTTCCCCACCTCAACTCCATTCCAACTCCAACCGTATCCTCCTCCGACGAATGCCGCGAAGAGTTCTCACCGTAAAAATGGCGAAAAATTCAACCACACAGAATGATGATGGCGATACCCGCCCAAAACCCAC...

CDS

Download CDS FASTA

1503 bp · LXL04_024941|LXL04_024941|OH1004|CDS

ATGCTACATATATATGTACCCACAATTTCAGCAGTTCCTACTTACTCCCAAACTCCTATTTGGGACTTTGGGTCATCTTGTTACCAAATGGCTTTCTGTAATCCCCCCACCCTTTTACCTTCATTGTCTTCCCCACCTCAACTCCATTCCAACTCCAACCGTATCCTCCTCCGACGAATGCCGCGAAGAGTTCTCACCGTAAAAATGGCGAAAAATTCAACCACACAGAATGATGATGGCGATACCCGCCCAAAACCCAC...

Protein

Download Protein FASTA

500 aa · LXL04_024941|LXL04_024941|OH1004|PROTEIN

MLHIYVPTISAVPTYSQTPIWDFGSSCYQMAFCNPPTLLPSLSSPPQLHSNSNRILLRRMPRRVLTVKMAKNSTTQNDDGDTRPKPTKFVTFLGKGGSGKTFSAVFAAQHYAMKGLKTCLVLHSQDPTADYILNQKIGTAPVTCNDNLSAVRLETTKMIIEPLNQLKQADARLNLTQGVLEGVVGEEFGVLPGMDTIFSALALEKLIGFLRNKTQKNNYDVVIYDGLSTEETIRLIGATGKSRLYIKYLRNLAEKTDLGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024941`
TK1151 ID	TkA06G094810
OH-1004 ID	LXL04_024941
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 97.275 / OH-1004 92.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024941

Location Chr05:102505826-102508360 (-)

Description Similar to At1g26090: Uncharacterized protein At1g26090, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26090`	ATPase binding tail-anchored (TA) integral membrane protein and required for the homeostasis of photosynthetic machinery.	Structures of Get3d reveal a distinct architecture associated with the emergence of photosynthesis.2023 · DOI: 10.1016/j.jbc.2023.104752

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0071806 protein transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015446 ATPase-coupled arsenite transmembrane transporter activity Molecular Function

GO:0015450 protein-transporting ATPase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G26090

cte:CT1945

syn:sll0086

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · LXL04_024941 · OH-1004

Mitochondrion0.045

Rank 2 · LXL04_024941 · OH-1004

Nucleus0.022

Rank 3 · LXL04_024941 · OH-1004

Cytoplasm0.022

Rank 4 · LXL04_024941 · OH-1004

Peroxisome0.014

Rank 5 · LXL04_024941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02374.22ArsA_ATPase87-318 aa

PF17886.8ArsA_HSP20418-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024941	`PF02374.22`	ArsA_ATPase	87	318	4.4e-19	69.5
LXL04_024941	`PF17886.8`	ArsA_HSP20	418	462	3.3e-09	36.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DYE4`	Arabidopsis thaliana	ATPase GET3D, chloroplastic	60.732%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card