LXL04_024926 | RubberDandelionOmics

Gene overview

LXL04_024926

Reference: OH-1004 Chr: Chr05 Coordinates: 102264354-102264800 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · LXL04_024926|LXL04_024926|OH1004|cDNA

ATGTTGACTCCCAAACTGTTCAATAATTCAGTACGCAATTTGTCTTCATTTGTAGCTTATCTCAACTGGGTTTGGGATTTCTTCATCCACCTTTCGTTCTTTTACCATCAAACGTTGTTACTGCGCGTGTCTAAAGGCAGTCAAACTGAACTTATTTCCAGCCCGTTTAGCCACGACTGGAGCTCAACAGAGCCGGTGGAATGTCCAGTGTGTTTGTCAGccattgaagaagatgaagagataAGTGTGCTTAGATGTAA...

CDS

Download CDS FASTA

447 bp · LXL04_024926|LXL04_024926|OH1004|CDS

ATGTTGACTCCCAAACTGTTCAATAATTCAGTACGCAATTTGTCTTCATTTGTAGCTTATCTCAACTGGGTTTGGGATTTCTTCATCCACCTTTCGTTCTTTTACCATCAAACGTTGTTACTGCGCGTGTCTAAAGGCAGTCAAACTGAACTTATTTCCAGCCCGTTTAGCCACGACTGGAGCTCAACAGAGCCGGTGGAATGTCCAGTGTGTTTGTCAGCCATTGAAGAAGATGAAGAGATAAGTGTGCTTAGATGTAA...

Protein

Download Protein FASTA

148 aa · LXL04_024926|LXL04_024926|OH1004|PROTEIN

MLTPKLFNNSVRNLSSFVAYLNWVWDFFIHLSFFYHQTLLLRVSKGSQTELISSPFSHDWSSTEPVECPVCLSAIEEDEEISVLRCKHLFHRNCIDRCIEHRHMTCPLCRDYLAGPRMVCELGRELIVFTFGGDGGSSDDEFDKWWLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024926`
TK1151 ID	TkA06G095380
OH-1004 ID	LXL04_024926
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024926

Location Chr05:102264354-102264800 (-)

Description Similar to BRH1: Brassinosteroid-responsive RING protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61460`	May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.	Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
`At2g04240`	Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.	Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
`At2g01150`	E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.	The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214
`At4g38140`	RING-H2 finger protein ATL18.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024926 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009687 abscisic acid metabolic process Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010200 response to chitin Biological Process

GO:0016055 Wnt signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G01150

ath:AT2G04240

ath:AT3G61460

ath:AT4G38140

hsa:54894

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.429

Rank 1 · LXL04_024926 · OH-1004

Cytoplasm0.384

Rank 2 · LXL04_024926 · OH-1004

Endoplasmic reticulum0.135

Rank 3 · LXL04_024926 · OH-1004

Cell membrane0.108

Rank 4 · LXL04_024926 · OH-1004

Mitochondrion0.086

Rank 5 · LXL04_024926 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_267-110 aa

PF17123.12zf-RING_1167-95 aa

PF14634.13zf-RING_567-110 aa

PF13923.13zf-C3HC4_267-109 aa

PF00097.32zf-C3HC468-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024926	`PF13639.13`	zf-RING_2	67	110	6.3e-11	43.1
LXL04_024926	`PF17123.12`	zf-RING_11	67	95	1e-09	38.6
LXL04_024926	`PF14634.13`	zf-RING_5	67	110	1.1e-06	29.2
LXL04_024926	`PF13923.13`	zf-C3HC4_2	67	109	2.5e-06	27.9
LXL04_024926	`PF00097.32`	zf-C3HC4	68	109	3.1e-08	34.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XF92`	Arabidopsis thaliana	Brassinosteroid-responsive RING protein 1	44.444%	Swiss-Prot	weak database homology
`Q9SI09`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase XERICO	50.000%	Swiss-Prot	weak database homology
`Q9ZU51`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RHA2B	39.655%	Swiss-Prot	weak database homology
`Q9SZL4`	Arabidopsis thaliana	RING-H2 finger protein ATL18	42.373%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card