LXL04_024917 | RubberDandelionOmics

Gene overview

LXL04_024917

Reference: OH-1004 Chr: Chr05 Coordinates: 102165832-102168629 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_024917|LXL04_024917|OH1004|cDNA

ATGAATTTCCGAGAAAAGTTTTTCTCATCAATTTTGTACTTAAATCAATCGAAAATGGGAGTCAAGTCATTCGTTGAGGGTGGTATAGCATCAATTATCGCCGGATGTTCCACCCACCCACTTGATCTCATAAAGGTCCGGATGCAGCTCCAAGGGGAAAATCACTCCGCCGCCGGAGCCACCCGCCCTCCCCGCGTTGGCCCAGTTGGCGTTGGAATGCAGATCATCCGACAAGACGGTTTTCGGGCGCTTTTCTCCGG...

CDS

Download CDS FASTA

1020 bp · LXL04_024917|LXL04_024917|OH1004|CDS

ATGAATTTCCGAGAAAAGTTTTTCTCATCAATTTTGTACTTAAATCAATCGAAAATGGGAGTCAAGTCATTCGTTGAGGGTGGTATAGCATCAATTATCGCCGGATGTTCCACCCACCCACTTGATCTCATAAAGGTCCGGATGCAGCTCCAAGGGGAAAATCACTCCGCCGCCGGAGCCACCCGCCCTCCCCGCGTTGGCCCAGTTGGCGTTGGAATGCAGATCATCCGACAAGACGGTTTTCGGGCGCTTTTCTCCGG...

Protein

Download Protein FASTA

339 aa · LXL04_024917|LXL04_024917|OH1004|PROTEIN

MNFREKFFSSILYLNQSKMGVKSFVEGGIASIIAGCSTHPLDLIKVRMQLQGENHSAAGATRPPRVGPVGVGMQIIRQDGFRALFSGVSATMLRQTLYSTTRMGLYDIMKTKWTDPNTGIIPLWQKIGAGLIAGAIGAAVGNPADVAMVRMQADGRVPAAERRNYKSVVDAISQMAKNEGIGSLWRGSSLTVNRAMLVTASQLASYDQFKETILNKGLMKDGLGTHVTASFGAGFVAAVVTNPVDVIKTRVMNMRVVAGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024917`
TK1151 ID	TkA06G095870
OH-1004 ID	LXL04_024917
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.659 / OH-1004 86.136 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024917

Location Chr05:102165832-102168629 (+)

Description Similar to PUMP5: Mitochondrial uncoupling protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22500`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	The plant energy-dissipating mitochondrial systems: depicting the genomic structure and the expression profiles of the gene families of uncoupling protein and alternative oxidase in monocots and dicots.2006 · DOI: 10.1093/jxb/erj070 Molecular identification of three Arabidopsis thaliana mitochondrial dicarboxylate carrier isoforms: organ distribution, bacterial expression, reconstitution into liposomes and functional characterization.2008 · DOI: 10.1042/bj20070867
`At4g24570`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	Molecular identification of three Arabidopsis thaliana mitochondrial dicarboxylate carrier isoforms: organ distribution, bacterial expression, reconstitution into liposomes and functional characterization.2008 · DOI: 10.1042/bj20070867
`At5g09470`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	Molecular identification of three Arabidopsis thaliana mitochondrial dicarboxylate carrier isoforms: organ distribution, bacterial expression, reconstitution into liposomes and functional characterization.2008 · DOI: 10.1042/bj20070867

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024917 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006835 dicarboxylic acid transport Biological Process

GO:0006839 mitochondrial transport Biological Process

GO:0015709 thiosulfate transport Biological Process

GO:0015729 oxaloacetate transport Biological Process

GO:0035435 phosphate ion transmembrane transport Biological Process

GO:0043490 malate-aspartate shuttle Biological Process

GO:0071422 succinate transmembrane transport Biological Process

GO:0071423 malate transmembrane transport Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:1902600 proton transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT2G22500

ath:AT4G24570

ath:AT5G09470

ddi:DDB_G0284225

mmu:67863

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.910

Rank 1 · LXL04_024917 · OH-1004

Cytoplasm0.030

Rank 2 · LXL04_024917 · OH-1004

Nucleus0.022

Rank 3 · LXL04_024917 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_024917 · OH-1004

Plastid0.011

Rank 5 · LXL04_024917 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr21-114 aa

PF00153.33Mito_carr122-216 aa

PF00153.33Mito_carr223-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024917	`PF00153.33`	Mito_carr	21	114	3.8e-65	216.4
LXL04_024917	`PF00153.33`	Mito_carr	122	216	3.8e-65	216.4
LXL04_024917	`PF00153.33`	Mito_carr	223	310	3.8e-65	216.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJY5`	Arabidopsis thaliana	Mitochondrial uncoupling protein 5	74.267%	Swiss-Prot	strong database homology
`Q9SB52`	Arabidopsis thaliana	Mitochondrial uncoupling protein 4	67.834%	Swiss-Prot	strong database homology
`Q9FY68`	Arabidopsis thaliana	Mitochondrial uncoupling protein 6	54.790%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card