LXL04_024915 | RubberDandelionOmics

Gene overview

LXL04_024915

Reference: OH-1004 Chr: Chr05 Coordinates: 102156806-102160891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2730 bp · LXL04_024915|LXL04_024915|OH1004|cDNA

ATGACTTCATTGACCTGCACCAACTTCACACTGCTCACCACAGCTTCAATTCTGCTTCAGATCGCCGGTCTCTGGCTCTTCGTCTTTGGATTCTTCCCTATTAAACCAGCTCTCTCCGGTGTCAGTGGACCAGAGAGTTTCCGGCCTCCCTCACGCGATTCAGTTGAGAATCAAAATGTCACAGCTCTGCATCCCGACCAGCTTAAGTCATTGTACCAGGAACTTTCTGAGATCCCACCTTCTTATGACCGATTGATACT...

CDS

Download CDS FASTA

2730 bp · LXL04_024915|LXL04_024915|OH1004|CDS

ATGACTTCATTGACCTGCACCAACTTCACACTGCTCACCACAGCTTCAATTCTGCTTCAGATCGCCGGTCTCTGGCTCTTCGTCTTTGGATTCTTCCCTATTAAACCAGCTCTCTCCGGTGTCAGTGGACCAGAGAGTTTCCGGCCTCCCTCACGCGATTCAGTTGAGAATCAAAATGTCACAGCTCTGCATCCCGACCAGCTTAAGTCATTGTACCAGGAACTTTCTGAGATCCCACCTTCTTATGACCGATTGATACT...

Protein

Download Protein FASTA

909 aa · LXL04_024915|LXL04_024915|OH1004|PROTEIN

MTSLTCTNFTLLTTASILLQIAGLWLFVFGFFPIKPALSGVSGPESFRPPSRDSVENQNVTALHPDQLKSLYQELSEIPPSYDRLILMVIDGLPAEFVLGRDGEPPLKTLKDAMPYTQSLLANKMALGFHSKAAPPTVTLPRLKAMTTGSIGGFLDVLFNFNTQALLEDNIVGQLFRIGWKMVMFGDETWLKLFPGLFTQHDGVSSFFVKDTVQVDHNVSRHLNHELFKSDWNLLILHYLGLDHVGHLGGRTSSLMGPKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024915`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_024915`
Location	Chr05:102156806-102160891 (+)
Description	Similar to LAS21: GPI ethanolamine phosphate transferase 2 (Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024915` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006506 GPI anchor biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0016740 transferase activity Molecular Function GO:0016780 phosphotransferase activity, for other substituted phosphate groups Molecular Function GO:0051267 CP2 mannose-ethanolamine phosphotransferase activity Molecular Function
KEGG gene cross-reference	afm:AFUA_6G05260 hsa:54872 kla:KLLA0_F01705g These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.729

Rank 1 · LXL04_024915 · OH-1004

Nucleus0.116

Rank 2 · LXL04_024915 · OH-1004

Golgi apparatus0.091

Rank 3 · LXL04_024915 · OH-1004

Cell membrane0.084

Rank 4 · LXL04_024915 · OH-1004

Cytoplasm0.080

Rank 5 · LXL04_024915 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01663.28Phosphodiest225-298 aa

PF19316.5PIGO_PIGG458-892 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024915	`PF01663.28`	Phosphodiest	225	298	3.4e-07	30.9
LXL04_024915	`PF19316.5`	PIGO_PIGG	458	892	2.3e-28	100.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card