RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_024848
Reference: OH-1004 Chr: Chr05 Coordinates: 100409320-100415671 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2658 bp · LXL04_024848|LXL04_024848|OH1004|cDNA

ATGTTGATGGATACGATGTTCGGGGATAGAGGTTGTCGGGGAAGATGCAGATGGTCCGTGGTTATTTTGATTGATCTCAATCGATCAGAAGCTTTAATTTGGGAACGCCCGTCGTTGATTGATAGAATGAGGATCGGATCAACGACAGTGGCTCACAGAGAAAAGGAAAGGCGGAGGAAGGCGGTGGAAGATTCCGATCAGGATGAAGTTGTGGGGGAGGAGTACGTGGTGGAGGACGTGCGAGATCACGATCACGGGAG...

CDS

Download CDS FASTA

2658 bp · LXL04_024848|LXL04_024848|OH1004|CDS

ATGTTGATGGATACGATGTTCGGGGATAGAGGTTGTCGGGGAAGATGCAGATGGTCCGTGGTTATTTTGATTGATCTCAATCGATCAGAAGCTTTAATTTGGGAACGCCCGTCGTTGATTGATAGAATGAGGATCGGATCAACGACAGTGGCTCACAGAGAAAAGGAAAGGCGGAGGAAGGCGGTGGAAGATTCCGATCAGGATGAAGTTGTGGGGGAGGAGTACGTGGTGGAGGACGTGCGAGATCACGATCACGGGAG...

Protein

Download Protein FASTA

885 aa · LXL04_024848|LXL04_024848|OH1004|PROTEIN

MLMDTMFGDRGCRGRCRWSVVILIDLNRSEALIWERPSLIDRMRIGSTTVAHREKERRRKAVEDSDQDEVVGEEYVVEDVRDHDHGRLAKRRSRFTLLAGDLGLDQNRRVFSRDKFIDGIKGCSPGFYIHPQNSWYRAWEKFILIWAVYSSFFTPMEFGFFRGLPKNLYFLDIAGQLAFLIDVGLHFFIAYRDTQTYKMISNRNLIAVRYLKSHFLFDILACMPWDNIYRASGRKEEVRYLLLLRLVRVRKVLEFFSRLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_024848
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_024848
LocationChr05:100409320-100415671 (-)
DescriptionSimilar to SKOR: Potassium channel SKOR
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02850 Highly selective outward-rectifying potassium channel.
Identification and disruption of a plant shaker-like outward channel involved in K+ release into the xylem sap.1998 · DOI: 10.1016/s0092-8674(00)81606-2
At5g37500 Major selective outward-rectifying potassium channel of the guard cell membrane.
The Arabidopsis outward K+ channel GORK is involved in regulation of stomatal movements and plant transpiration.2003 · DOI: 10.1073/pnas.0733970100
At2g26650 May act as a highly selective inward-rectifying potassium channel mediating root potassium uptake under low K⁺ conditions.
Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011
A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103
A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104
High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369
A role for the AKT1 potassium channel in plant nutrition.1998 · DOI: 10.1126/science.280.5365.918

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0250600 Probable outward-rectifying potassium channel. No verified direct reference in this release
Os04g0445000 Probable outward-rectifying potassium channel. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024848 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006811 monoatomic ion transport Biological Process
GO:0006813 potassium ion transport Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0010118 stomatal movement Biological Process
GO:0048767 root hair elongation Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0055075 potassium ion homeostasis Biological Process
GO:0090333 regulation of stomatal closure Biological Process
KEGG gene cross-reference
ath:AT2G26650
ath:AT3G02850
ath:AT5G37500
dosa:Os04g0445000
dosa:Os06g0250600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.696
Rank 1 · LXL04_024848 · OH-1004
Cytoplasm0.166
Rank 2 · LXL04_024848 · OH-1004
Endoplasmic reticulum0.116
Rank 3 · LXL04_024848 · OH-1004
Lysosome / Vacuole0.071
Rank 4 · LXL04_024848 · OH-1004
Golgi apparatus0.063
Rank 5 · LXL04_024848 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans136-386 aa
PF07885.23Ion_trans_2325-382 aa
PF00027.36cNMP_binding476-561 aa
PF13637.13Ank_4610-655 aa
PF12796.14Ank_2610-695 aa
PF13857.13Ank_5621-672 aa
PF00023.37Ank634-666 aa
PF13637.13Ank_4643-683 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_024848PF00520.38Ion_trans1363861.9e-28100.0
LXL04_024848PF07885.23Ion_trans_23253826.6e-0833.0
LXL04_024848PF00027.36cNMP_binding4765611.3e-1867.4
LXL04_024848PF13637.13Ank_46106552.7e-2898.1
LXL04_024848PF12796.14Ank_26106957.3e-2897.7
LXL04_024848PF13857.13Ank_56216724.9e-1968.9
LXL04_024848PF00023.37Ank6346661e-2692.2
LXL04_024848PF13637.13Ank_46436832.7e-2898.1
LXL04_024848PF13637.13Ank_47037522.7e-2898.1
LXL04_024848PF12796.14Ank_27037857.3e-2897.7
LXL04_024848PF13857.13Ank_57197704.9e-1968.9
LXL04_024848PF00023.37Ank7337621e-2692.2
LXL04_024848PF11834.14KHA8098814.1e-1969.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M8S6Arabidopsis thalianaPotassium channel SKOR68.949%Swiss-Protstrong database homology
Q94A76Arabidopsis thalianaPotassium channel GORK67.192%Swiss-Protstrong database homology
Q38998Arabidopsis thalianaPotassium channel AKT134.599%Swiss-Protmoderate database homology
Q653P0Oryza sativa subsp. japonicaPotassium channel KOR166.121%Swiss-Protstrong database homology
Q7XUW4Oryza sativa subsp. japonicaPotassium channel KOR257.123%Swiss-Protstrong database homology

JBrowse

View in Genome Browser