LXL04_024836 | RubberDandelionOmics

Gene overview

LXL04_024836

Reference: OH-1004 Chr: Chr05 Coordinates: 100130839-100131498 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_024836|LXL04_024836|OH1004|cDNA

ATGTGTTCATATCCAAATCCAGAATTCTTCCCTAAGTCTCCTTCTTCATGGGATGAGCTTCTATTCTCACATGATATGCTCTCAGAAGTCCAAATAAAAGAAGAAGATACATATTTCCAAGATCATAGTAACGACCATTATCATGAGCTTTCCTCCGATACAGATCTAAGCAAACCCTCTCTCAACCGAAAGCAGATCTTGGAAGTGATTACAAAGCCAGAAAAAGAGCCTGATGTCGAGAAAATACGATTCATAGGCGT...

CDS

Download CDS FASTA

660 bp · LXL04_024836|LXL04_024836|OH1004|CDS

ATGTGTTCATATCCAAATCCAGAATTCTTCCCTAAGTCTCCTTCTTCATGGGATGAGCTTCTATTCTCACATGATATGCTCTCAGAAGTCCAAATAAAAGAAGAAGATACATATTTCCAAGATCATAGTAACGACCATTATCATGAGCTTTCCTCCGATACAGATCTAAGCAAACCCTCTCTCAACCGAAAGCAGATCTTGGAAGTGATTACAAAGCCAGAAAAAGAGCCTGATGTCGAGAAAATACGATTCATAGGCGT...

Protein

Download Protein FASTA

219 aa · LXL04_024836|LXL04_024836|OH1004|PROTEIN

MCSYPNPEFFPKSPSSWDELLFSHDMLSEVQIKEEDTYFQDHSNDHYHELSSDTDLSKPSLNRKQILEVITKPEKEPDVEKIRFIGVRKRPWGKFAAEIRDSTRNGIRVWLGTFDSAEEAALIYDQAAFSMRGSSTQLNFPMERVKESLKGKSYSCFRDGLSPAAAIKETHRARNCKWKRNNKNQACSQTPFVFEDLGSDLLDQLLLGTSECSSSSTSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024836`
TK1151 ID	TkA06G103140
OH-1004 ID	LXL04_024836
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 88.584 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024836

Location Chr05:100130839-100131498 (-)

Description Similar to ERF1B: Ethylene-responsive transcription factor 1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23240`	Acts as a transcriptional activator.	Constitutive expression of ETHYLENE-RESPONSE-FACTOR1 in Arabidopsis confers resistance to several necrotrophic fungi.2002 · DOI: 10.1046/j.1365-313x.2002.01191.x Ethylene response factor 1 mediates Arabidopsis resistance to the soilborne fungus Fusarium oxysporum.2004 · DOI: 10.1094/mpmi.2004.17.7.763 Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.1998 · DOI: 10.1101/gad.12.23.3703
`At2g31230`	May act as a transcriptional activator.	No verified direct reference in this release
`At1g06160`	Probably acts as a transcriptional activator.	The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense.2008 · DOI: 10.1104/pp.108.117523

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024836 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G06160

ath:AT2G31230

ath:AT3G23240

sly:544042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · LXL04_024836 · OH-1004

Cytoplasm0.127

Rank 2 · LXL04_024836 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_024836 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_024836 · OH-1004

Plastid0.019

Rank 5 · LXL04_024836 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP283-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024836	`PF00847.27`	AP2	83	134	5.2e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDC8`	Arabidopsis thaliana	Ethylene-responsive transcription factor 1B	57.246%	Swiss-Prot	moderate database homology
`Q8VYM0`	Arabidopsis thaliana	Ethylene-responsive transcription factor 15	45.402%	Swiss-Prot	moderate database homology
`Q9LND1`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF094	65.556%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card