LXL04_024810 | RubberDandelionOmics

Gene overview

LXL04_024810

Reference: OH-1004 Chr: Chr05 Coordinates: 99398903-99401132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_024810|LXL04_024810|OH1004|cDNA

CAAATCCTAGAAAACACGTGTCACAATCGTGTAAACTTGCATTCAACATTCCCTTTAAAGTTAAGTTACCAACCGAATCACCCCCAAATTACAAACGCAGGTATGAATCAGGAGGTCACCAATGGAGCCTCAAAATCCAAAAGGAATTCCAAAAAACCCGAATATTCTAGGTTTACACAGCAAGAGCTTCCGGCCTGGAAACCAATCCTAACCCCAGGATGGGTAATCACATCGTTTCTAGCAATTGCCATGTTGTTCAT...

CDS

Download CDS FASTA

1095 bp · LXL04_024810|LXL04_024810|OH1004|CDS

TTGCATTCAACATTCCCTTTAAAGTTAAGTTACCAACCGAATCACCCCCAAATTACAAACGCAGGTATGAATCAGGAGGTCACCAATGGAGCCTCAAAATCCAAAAGGAATTCCAAAAAACCCGAATATTCTAGGTTTACACAGCAAGAGCTTCCGGCCTGGAAACCAATCCTAACCCCAGGATGGGTAATCACATCGTTTCTAGCAATTGCCATGTTGTTCATCCCAATCGGACTTGTCTCTCTCTTTGCATCTGAACG...

Protein

Download Protein FASTA

364 aa · LXL04_024810|LXL04_024810|OH1004|PROTEIN

MHSTFPLKLSYQPNHPQITNAGMNQEVTNGASKSKRNSKKPEYSRFTQQELPAWKPILTPGWVITSFLAIAMLFIPIGLVSLFASERVVEIVYRYDQDCVPEMYRGNVTSYIQNPLTNKTCIKNVTVPKKMAAPIFVYYQLDNFYQNHRRYVKSRSDKQLRNADDAFSTKGCEPEAKLSGNEPIVPCGLIAWSLFNDTYNLIMQKKSLDINKKGIAWKSDTKVKFGSNVFPKNFQSGSLIGGGKLNQSIPLSEQEDLIVW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024810`
TK1151 ID	TkA06G106400
OH-1004 ID	LXL04_024810
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 92.042 / OH-1004 95.330 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024810

Location Chr05:99398903-99401132 (+)

Description Similar to ALIS5: ALA-interacting subunit 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79450`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At3g12740`	Required for the lipid transport activity of the ALA/ALIS P4- ATPase complex.	The Arabidopsis P4-ATPase ALA3 localizes to the golgi and requires a beta-subunit to function in lipid translocation and secretory vesicle formation.2008 · DOI: 10.1105/tpc.107.054767
`At1g54320`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At1g16360`	Putative ALA-interacting subunit 4.	No verified direct reference in this release
`At5g46150`	Putative ALA-interacting subunit 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024810 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015914 phospholipid transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G16360

ath:AT1G54320

ath:AT1G79450

ath:AT3G12740

ath:AT5G46150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.341

Rank 1 · LXL04_024810 · OH-1004

Golgi apparatus0.321

Rank 2 · LXL04_024810 · OH-1004

Cytoplasm0.316

Rank 3 · LXL04_024810 · OH-1004

Lysosome / Vacuole0.209

Rank 4 · LXL04_024810 · OH-1004

Endoplasmic reticulum0.157

Rank 5 · LXL04_024810 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03381.21CDC5082-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024810	`PF03381.21`	CDC50	82	347	1.2e-89	301.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8W0`	Arabidopsis thaliana	ALA-interacting subunit 5	67.584%	Swiss-Prot	strong database homology
`Q9LTW0`	Arabidopsis thaliana	ALA-interacting subunit 1	67.692%	Swiss-Prot	strong database homology
`Q9SLK2`	Arabidopsis thaliana	ALA-interacting subunit 3	66.871%	Swiss-Prot	strong database homology
`Q9SA35`	Arabidopsis thaliana	Putative ALA-interacting subunit 4	67.610%	Swiss-Prot	strong database homology
`Q67YS6`	Arabidopsis thaliana	Putative ALA-interacting subunit 2	55.215%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card