Gene Card
Gene overview
cDNA / CDS / Protein Sequences
477 bp · LXL04_024786|LXL04_024786|OH1004|cDNA
ATGCCAGTACTGAAGCTGACTATCGGAGAGAAAATGGCCGGAAGAGTTGAGTTGTTGTTACCAAAAGAATATGGATACGTCATTCTCACAATCGCTGCCTACTGTTTTCTCAACGCCTATATGCAGATTCAAGTCGGCAAAGCACGAAAGAAGTACGGTGTGCCGTACCCTATAATGTACGCTGCCGAAGCTGATAGCAAGGATTACAAAATCTATAACTGTGTTCAGAGAGGGCATCAAAATTCACTGGAAGCTCTACC...
477 bp · LXL04_024786|LXL04_024786|OH1004|CDS
ATGCCAGTACTGAAGCTGACTATCGGAGAGAAAATGGCCGGAAGAGTTGAGTTGTTGTTACCAAAAGAATATGGATACGTCATTCTCACAATCGCTGCCTACTGTTTTCTCAACGCCTATATGCAGATTCAAGTCGGCAAAGCACGAAAGAAGTACGGTGTGCCGTACCCTATAATGTACGCTGCCGAAGCTGATAGCAAGGATTACAAAATCTATAACTGTGTTCAGAGAGGGCATCAAAATTCACTGGAAGCTCTACC...
Protein
Download Protein FASTA158 aa · LXL04_024786|LXL04_024786|OH1004|PROTEIN
MPVLKLTIGEKMAGRVELLLPKEYGYVILTIAAYCFLNAYMQIQVGKARKKYGVPYPIMYAAEADSKDYKIYNCVQRGHQNSLEALPIFFVLMVLGGIKRPLICSALGIVYIVSRYFYFSGYSSGDPKGRLPIGKYNNLAMLGLLIVNMWFGVSLLMA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_024786 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_024786 |
|---|---|
| Location | Chr05:98914052-98915018 (-) |
| Description | Similar to MGST3: Microsomal glutathione S-transferase 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0006692 prostanoid metabolic process Biological Process GO:0006750 glutathione biosynthetic process Biological Process GO:0019369 arachidonate metabolic process Biological Process GO:0019370 leukotriene biosynthetic process Biological Process GO:0032496 response to lipopolysaccharide Biological Process GO:0046466 membrane lipid catabolic process Biological Process GO:0005635 nuclear envelope Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component |
| KEGG gene cross-reference | bta:507346 bta:615552 hsa:4258 hsa:4259 mmu:66447 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01124.24MAPEG28-149 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_024786 | PF01124.24 | MAPEG | 28 | 149 | 1.9e-25 | 90.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.