LXL04_024753 | RubberDandelionOmics

Gene overview

LXL04_024753

Reference: OH-1004 Chr: Chr05 Coordinates: 98086056-98089798 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1956 bp · LXL04_024753|LXL04_024753|OH1004|cDNA

ATGACAGCACAAGCCAACGCCGAGTTAAAATTCGAAAACTATGCCTTGGTAAGCCGAGATGCCCTGCAGATTACTCCCACCCCCGACAGCAACCCGATGGTATTCGGCATCCAGAACCAGTCCGGCAGGGTAATGTTCCGTGAACGGTTCAAGCTATGGGACGGCGACGCCAACAGTAACGCCACCGTCGCCTCCTTCACCACCTCCTTCCTCGTCAACATGTTCCCAAACAACGGTACCCCAGGAGAAGGTTTAAGCTT...

CDS

Download CDS FASTA

1956 bp · LXL04_024753|LXL04_024753|OH1004|CDS

ATGACAGCACAAGCCAACGCCGAGTTAAAATTCGAAAACTATGCCTTGGTAAGCCGAGATGCCCTGCAGATTACTCCCACCCCCGACAGCAACCCGATGGTATTCGGCATCCAGAACCAGTCCGGCAGGGTAATGTTCCGTGAACGGTTCAAGCTATGGGACGGCGACGCCAACAGTAACGCCACCGTCGCCTCCTTCACCACCTCCTTCCTCGTCAACATGTTCCCAAACAACGGTACCCCAGGAGAAGGTTTAAGCTT...

Protein

Download Protein FASTA

651 aa · LXL04_024753|LXL04_024753|OH1004|PROTEIN

MTAQANAELKFENYALVSRDALQITPTPDSNPMVFGIQNQSGRVMFRERFKLWDGDANSNATVASFTTSFLVNMFPNNGTPGEGLSFLIAPNLDIPLNSYGQYLGLTNATTDNQTSNGIVAVELDTVRQSFDIDNNHIGLNIHSVRSVVSESLTPLNITLAPDPPAFHNIWVEYNGTEKIIRIYIADQAEMNGPTPSKPATPIIQRNLDLRTTVNQHSYFGFAASTGTLVELNCIRRWNITINYFPEPEGPWLKIALGVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024753`
TK1151 ID	TkA06G112180
OH-1004 ID	LXL04_024753
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024753

Location Chr05:98086056-98089798 (+)

Description Similar to LECRKS5: Probable L-type lectin-domain containing receptor kinase S.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06740`	Probable L-type lectin-domain containing receptor kinase S.5.	No verified direct reference in this release
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At3g53810`	Required during pollen development.	No verified direct reference in this release
`At2g37710`	L-type lectin-domain containing receptor kinase IV.1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0640500`	Lectin-domain containing receptor kinase involved in salt stress response.	The Receptor-Like Kinase SIT1 Mediates Salt Sensitivity by Activating MAPK3/6 and Regulating Ethylene Homeostasis in Rice.2014 · DOI: 10.1105/tpc.114.125187 Mutual Regulation of Receptor-Like Kinase SIT1 and B'κ-PP2A Shapes the Early Response of Rice to Salt Stress.2019 · DOI: 10.1105/tpc.18.00706

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024753 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009555 pollen development Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G37710

ath:AT3G53810

ath:AT5G06740

ath:AT5G55830

dosa:Os02g0640500

osa:4330111

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.848

Rank 1 · LXL04_024753 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_024753 · OH-1004

Endoplasmic reticulum0.066

Rank 3 · LXL04_024753 · OH-1004

Nucleus0.054

Rank 4 · LXL04_024753 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_024753 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139.27Lectin_legB5-245 aa

PF18483.9Lectin_L-type_dom63-234 aa

PF00069.32Pkinase318-564 aa

PF07714.24PK_Tyr_Ser-Thr320-586 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024753	`PF00139.27`	Lectin_legB	5	245	7.4e-56	190.2
LXL04_024753	`PF18483.9`	Lectin_L-type_dom	63	234	3.7e-07	30.9
LXL04_024753	`PF00069.32`	Pkinase	318	564	5.4e-47	161.1
LXL04_024753	`PF07714.24`	PK_Tyr_Ser-Thr	320	586	1.5e-47	162.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG33`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase S.5	39.232%	Swiss-Prot	moderate database homology
`Q9FHG4`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase S.7	36.953%	Swiss-Prot	moderate database homology
`Q9M345`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.2	35.714%	Swiss-Prot	moderate database homology
`O80939`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.1	35.354%	Swiss-Prot	moderate database homology
`Q6H7D2`	Oryza sativa subsp. japonica	L-type lectin-domain containing receptor kinase SIT1	36.185%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card