LXL04_024728 | RubberDandelionOmics

Gene overview

LXL04_024728

Reference: OH-1004 Chr: Chr05 Coordinates: 97609070-97609540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_024728|LXL04_024728|OH1004|cDNA

ATGATGGAATCTGGGCAATCggacttgatgaacacttgGGATCTTGTAAATTGCTTGAAAGATTACAACTTGAAAGATGCAGATTGTCTGAGGGCACTTTTTCTTGTCTGTCAATCTGTTAGAGAAATGGTTGTAAAAGATTGCTGGGGTTTGAAAGATGGCATCTTCCTCAATGCCAATTTATGCAGGAGGGTAAAGTTGTTATGGATAGAAGGATGCTCAAGGCTGACAACAGAAGGAGTAGAAGCTGTGGTTCTTGA...

CDS

Download CDS FASTA

387 bp · LXL04_024728|LXL04_024728|OH1004|CDS

ATGATGGAATCTGGGCAATCGGACTTGATGAACACTTGGGATCTTGTAAATTGCTTGAAAGATTACAACTTGAAAGATGCAGATTGTCTGAGGGCACTTTTTCTTGTCTGTCAATCTGTTAGAGAAATGGTTGTAAAAGATTGCTGGGGTTTGAAAGATGGCATCTTCCTCAATGCCAATTTATGCAGGAGGGTAAAGTTGTTATGGATAGAAGGATGCTCAAGGCTGACAACAGAAGGAGTAGAAGCTGTGGTTCTTGA...

Protein

Download Protein FASTA

128 aa · LXL04_024728|LXL04_024728|OH1004|PROTEIN

MMESGQSDLMNTWDLVNCLKDYNLKDADCLRALFLVCQSVREMVVKDCWGLKDGIFLNANLCRRVKLLWIEGCSRLTTEGVEAVVLDLKELESFNTNYRRNSEPPKKYTKFTKLSMLLKMLSLLLPAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024728`
TK1151 ID	TkA06G114380
OH-1004 ID	LXL04_024728
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024728

Location Chr05:97609070-97609540 (-)

Description Similar to At5g07670: F-box protein At5g07670

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07670`	F-box protein At5g07670.	No verified direct reference in this release
`At5g51380`	F-box protein At5g51380.	No verified direct reference in this release
`At5g51370`	F-box protein At5g51370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024728 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT5G07670

ath:AT5G51370

ath:AT5G51380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.473

Rank 1 · LXL04_024728 · OH-1004

Cytoplasm0.301

Rank 2 · LXL04_024728 · OH-1004

Mitochondrion0.135

Rank 3 · LXL04_024728 · OH-1004

Cell membrane0.075

Rank 4 · LXL04_024728 · OH-1004

Endoplasmic reticulum0.062

Rank 5 · LXL04_024728 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYT5`	Arabidopsis thaliana	F-box protein At5g07670	41.000%	Swiss-Prot	moderate database homology
`Q9FGN3`	Arabidopsis thaliana	F-box protein At5g51380	42.424%	Swiss-Prot	moderate database homology
`Q9FGN4`	Arabidopsis thaliana	F-box protein At5g51370	39.423%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card