LXL04_024717 | RubberDandelionOmics

Gene overview

LXL04_024717

Reference: OH-1004 Chr: Chr05 Coordinates: 97387598-97390029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · LXL04_024717|LXL04_024717|OH1004|cDNA

ATGGAAGAAACCCTAGACGAGCATACCAAATCATTAGCGGCTCCAATCATCTTCATTGTTGTCTTGGTTTTCCAGTTATCGGACAAGTTCTTAGCACATATGAAGACGAAAGCATCCGTGAGTGAGAGAGATGCCCAATTGCGTGCTGAAATCAAGCAACTGTTAAAGGAAGCATCCACTTTATCAGAGCCTTCAACATTTGCTCAATCTGCAAAGCTTAGAAGAATGGCAGTAGCTAAGGAGAAAGAGCTTGCAAAAAG...

CDS

Download CDS FASTA

534 bp · LXL04_024717|LXL04_024717|OH1004|CDS

ATGGAAGAAACCCTAGACGAGCATACCAAATCATTAGCGGCTCCAATCATCTTCATTGTTGTCTTGGTTTTCCAGTTATCGGACAAGTTCTTAGCACATATGAAGACGAAAGCATCCGTGAGTGAGAGAGATGCCCAATTGCGTGCTGAAATCAAGCAACTGTTAAAGGAAGCATCCACTTTATCAGAGCCTTCAACATTTGCTCAATCTGCAAAGCTTAGAAGAATGGCAGTAGCTAAGGAGAAAGAGCTTGCAAAAAG...

Protein

Download Protein FASTA

177 aa · LXL04_024717|LXL04_024717|OH1004|PROTEIN

MEETLDEHTKSLAAPIIFIVVLVFQLSDKFLAHMKTKASVSERDAQLRAEIKQLLKEASTLSEPSTFAQSAKLRRMAVAKEKELAKSQESASKEIKMSFSLYEKILMISKVVIYLTMIVWFWRIPVAAISKELVQPFGRFLSWKTGGSFNNNVMVGVIPWLILSTRVGKYLCNKVLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024717`
TK1151 ID	TkA06G115240
OH-1004 ID	LXL04_024717
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 81.193 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024717

Location Chr05:97387598-97390029 (+)

Description Similar to GET1: Protein GET1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16444`	Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024717 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane Biological Process

GO:0045048 protein insertion into ER membrane Biological Process

GO:0048767 root hair elongation Biological Process

GO:0050808 synapse organization Biological Process

GO:0050821 protein stabilization Biological Process

GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0043529 GET complex Cellular Component

GO:0043495 protein-membrane adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT4G16444

bta:509739

hsa:7485

pon:100173514

rno:288233

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.659

Rank 1 · LXL04_024717 · OH-1004

Nucleus0.113

Rank 2 · LXL04_024717 · OH-1004

Peroxisome0.098

Rank 3 · LXL04_024717 · OH-1004

Cytoplasm0.077

Rank 4 · LXL04_024717 · OH-1004

Mitochondrion0.066

Rank 5 · LXL04_024717 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04420.20CHD532-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024717	`PF04420.20`	CHD5	32	146	7.2e-10	39.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1H5D2`	Arabidopsis thaliana	Protein GET1	58.960%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card