LXL04_024693 | RubberDandelionOmics

Gene overview

LXL04_024693

Reference: OH-1004 Chr: Chr05 Coordinates: 96736401-96738055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_024693|LXL04_024693|OH1004|cDNA

ATGTTATCAACATTGATAAACTTTCTAAAAGCCTGCTGGCGACCCTCGGAGCGTTACCCATACACCACTTCCGACACCGCCGGCAAGCAAGAAGGTCTTCTTTGGTATAAAGACATCGGTCAGCATTTAAATGGCGAGTTCTCAATGGCGGTGGTTCAAGCTAACATGTTACTCGAAGATCAAAGCCAGATTGAATCCGGCTCATTAAGCTTTCTCGATTCTGGCCCATACGGAACTTTTATCGGCGTCTACGACGGTCA...

CDS

Download CDS FASTA

1218 bp · LXL04_024693|LXL04_024693|OH1004|CDS

ATGTTATCAACATTGATAAACTTTCTAAAAGCCTGCTGGCGACCCTCGGAGCGTTACCCATACACCACTTCCGACACCGCCGGCAAGCAAGAAGGTCTTCTTTGGTATAAAGACATCGGTCAGCATTTAAATGGCGAGTTCTCAATGGCGGTGGTTCAAGCTAACATGTTACTCGAAGATCAAAGCCAGATTGAATCCGGCTCATTAAGCTTTCTCGATTCTGGCCCATACGGAACTTTTATCGGCGTCTACGACGGTCA...

Protein

Download Protein FASTA

405 aa · LXL04_024693|LXL04_024693|OH1004|PROTEIN

MLSTLINFLKACWRPSERYPYTTSDTAGKQEGLLWYKDIGQHLNGEFSMAVVQANMLLEDQSQIESGSLSFLDSGPYGTFIGVYDGHGGPETSRYVNDHLFQNLKRIATEQQSMSVDVIQKAFHATEEGFVSIVAKQWIVKPQLAAVGSCCLVGVICNGVLYIANAGDSRAVLGRVVKATGEIIAIQLSTEHNASIESVRQELHRLHPDDPQIVVLKHNVWRVKGLIQISRSIGDVYLKKAEFNREPLYAKFRLRDPIRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024693`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024693

Location Chr05:96736401-96738055 (+)

Description Similar to Os06g0717800: Probable protein phosphatase 2C 60

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51370`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release
`At4g38520`	Dephosphorylates and represses plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release
`At5g66080`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0717800`	Probable protein phosphatase 2C 60.	No verified direct reference in this release
`Os03g0137200`	Probable protein phosphatase 2C 28.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024693 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1900036 positive regulation of cellular response to heat Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G51370

ath:AT4G38520

ath:AT5G66080

dosa:Os03g0137200

dosa:Os06g0717800

osa:4331548

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.337

Rank 1 · LXL04_024693 · OH-1004

Cytoplasm0.280

Rank 2 · LXL04_024693 · OH-1004

Nucleus0.184

Rank 3 · LXL04_024693 · OH-1004

Endoplasmic reticulum0.144

Rank 4 · LXL04_024693 · OH-1004

Golgi apparatus0.109

Rank 5 · LXL04_024693 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C79-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024693	`PF00481.27`	PP2C	79	323	7.3e-40	138.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD12`	Arabidopsis thaliana	Probable protein phosphatase 2C 46	76.178%	Swiss-Prot	strong database homology
`Q5PNS9`	Arabidopsis thaliana	Probable protein phosphatase 2C 64	70.707%	Swiss-Prot	strong database homology
`Q9FKX4`	Arabidopsis thaliana	Probable protein phosphatase 2C 79	74.479%	Swiss-Prot	strong database homology
`Q5Z8P0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 60	75.128%	Swiss-Prot	strong database homology
`Q10S32`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 28	71.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card