LXL04_024658 | RubberDandelionOmics

Gene overview

LXL04_024658

Reference: OH-1004 Chr: Chr05 Coordinates: 96066648-96067677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_024658|LXL04_024658|OH1004|cDNA

ATGGAAACTCAACAACAAGAGCAAGATTTAGGTAACAAAAGCAACAGTTATTTGTGTAGGCAGAGTAGTACGAGGTGGACACCCACAACTGATCAAATTAGAATCCTTAAAGAACTTTACTACAACAACGGAATCCGGTCACCAACTGCTGACCAGATTCAGAGGATCGCTGCTCGTTTAAGACATTACGGCAAAATCGAGGGCAAAAATGTGTTTTATTGGTTTCAGAACCATAAAGCTCGTGAGAGACAGAAAAAAAG...

CDS

Download CDS FASTA

846 bp · LXL04_024658|LXL04_024658|OH1004|CDS

ATGGAAACTCAACAACAAGAGCAAGATTTAGGTAACAAAAGCAACAGTTATTTGTGTAGGCAGAGTAGTACGAGGTGGACACCCACAACTGATCAAATTAGAATCCTTAAAGAACTTTACTACAACAACGGAATCCGGTCACCAACTGCTGACCAGATTCAGAGGATCGCTGCTCGTTTAAGACATTACGGCAAAATCGAGGGCAAAAATGTGTTTTATTGGTTTCAGAACCATAAAGCTCGTGAGAGACAGAAAAAAAG...

Protein

Download Protein FASTA

281 aa · LXL04_024658|LXL04_024658|OH1004|PROTEIN

METQQQEQDLGNKSNSYLCRQSSTRWTPTTDQIRILKELYYNNGIRSPTADQIQRIAARLRHYGKIEGKNVFYWFQNHKARERQKKRFTPAPITPPPPPPSANVLPSPFPDHHRMHVHSTHPPQFYHHQHKLYPNHQISPSEGGSTSASPGFVTVGYGYGSVAMEKSFKECSISPGETMVAGVKSQNFGSWVGFDSYSHEKMKREYEGQEEDDDTEGDLSAPIETLPLFPIHGGANHDIFNMKAAVEAEHNNGGCYAGGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024658`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024658

Location Chr05:96066648-96067677 (+)

Description Similar to WUS: Protein WUSCHEL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17950`	Transcription factor that plays a central role during early embryogenesis, oogenesis and flowering, probably by regulating expression of specific genes.	The WUSCHEL gene promotes vegetative-to-embryonic transition in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01289.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0663600`	Transcription repressor required for the formation and development of tiller buds and panicles.	MONOCULM 3, an ortholog of WUSCHEL in rice, is required for tiller bud formation.2015 · DOI: 10.1016/j.jgg.2014.12.005 Axillary Meristem Formation in Rice Requires the WUSCHEL Ortholog TILLERS ABSENT1.2015 · DOI: 10.1105/tpc.15.00074 Homeobox Is Pivotal for OsWUS Controlling Tiller Development and Female Fertility in Rice.2016 · DOI: 10.1534/g3.116.028837

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024658 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048653 anther development Biological Process

GO:0080166 stomium development Biological Process

GO:0090506 axillary shoot meristem initiation Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT2G17950

osa:107275471

sly:543793

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_024658 · OH-1004

Cytoplasm0.072

Rank 2 · LXL04_024658 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_024658 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_024658 · OH-1004

Plastid0.010

Rank 5 · LXL04_024658 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain24-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024658	`PF00046.36`	Homeodomain	24	84	8.8e-14	51.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB92`	Arabidopsis thaliana	Protein WUSCHEL	41.115%	Swiss-Prot	moderate database homology
`Q7XM13`	Oryza sativa subsp. japonica	WUSCHEL-related homeobox 1	80.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card