LXL04_024645 | RubberDandelionOmics

Gene overview

LXL04_024645

Reference: OH-1004 Chr: Chr05 Coordinates: 95896920-95897815 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_024645|LXL04_024645|OH1004|cDNA

ATGTCGTCAACCGGAAGTGATAAAGCAAACGTCGTTGCCGAGCAACCAGCGGCGGCGAAGGCCGTCGAGAAAAAGGCAAAAGCTCCGAAGGTGAAGAAGCCGAAAACTGCTAAAAGTGCTTCTCATCCTCCCTACTTCCAGATGATCAAAGAAGCCCTGTTGGCTCTGAAAGAGAAGGGCGGTTCGAGTCCACACGCAATCGCAAAGTACATGGAAGATAAACACAAGGCGGTGCTACCGGAGAATTTCAAGAAGATGTT...

CDS

Download CDS FASTA

615 bp · LXL04_024645|LXL04_024645|OH1004|CDS

ATGTCGTCAACCGGAAGTGATAAAGCAAACGTCGTTGCCGAGCAACCAGCGGCGGCGAAGGCCGTCGAGAAAAAGGCAAAAGCTCCGAAGGTGAAGAAGCCGAAAACTGCTAAAAGTGCTTCTCATCCTCCCTACTTCCAGATGATCAAAGAAGCCCTGTTGGCTCTGAAAGAGAAGGGCGGTTCGAGTCCACACGCAATCGCAAAGTACATGGAAGATAAACACAAGGCGGTGCTACCGGAGAATTTCAAGAAGATGTT...

Protein

Download Protein FASTA

204 aa · LXL04_024645|LXL04_024645|OH1004|PROTEIN

MSSTGSDKANVVAEQPAAAKAVEKKAKAPKVKKPKTAKSASHPPYFQMIKEALLALKEKGGSSPHAIAKYMEDKHKAVLPENFKKMLSLQLKNSASKGKLTKVKASYKLSESGKKEKAPAVAKKPTVADKKPKQTKSKKPAAPVARATAATTAGRPKKTTKATKTAVVKKQAPAKKAKKMTPAKAKQPKSIKSPAAKKARKASV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024645`
TK1151 ID	TkA06G121290
OH-1004 ID	LXL04_024645
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 66.176 / OH-1004 66.176 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024645

Location Chr05:95896920-95897815 (-)

Description Similar to Histone H1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30620`	Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024645 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0030261 chromosome condensation Biological Process

GO:0045910 negative regulation of DNA recombination Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003690 double-stranded DNA binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0031492 nucleosomal DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G30620

vcn:VOLCADRAFT_102808

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.784

Rank 1 · LXL04_024645 · OH-1004

Cytoplasm0.209

Rank 2 · LXL04_024645 · OH-1004

Extracellular0.079

Rank 3 · LXL04_024645 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_024645 · OH-1004

Endoplasmic reticulum0.026

Rank 5 · LXL04_024645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00538.26Linker_histone42-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024645	`PF00538.26`	Linker_histone	42	108	4.4e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P26569`	Arabidopsis thaliana	Histone H1.2	50.704%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card