LXL04_024606 | RubberDandelionOmics

Gene overview

LXL04_024606

Reference: OH-1004 Chr: Chr05 Coordinates: 95066656-95068239 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_024606|LXL04_024606|OH1004|cDNA

ATGGCGGCGACTCGTCGTGAAATTTTCCCGGTGACGCCGACGCTGTTGTCGCTGGTGGCGGCTTATGCCCCACAGTACACCCATGTCTTGCTCTTTCTTGTCTCAACGTTTAACCTCTCCCCTGAACTCCTATACAATATCTTCGCCGCCGTCCGACGCTACTGGAAACCTATTCCTAAATCCACAAAACTCACTCTCGTCTTCAAAGAGAAAGACGGCCTGGTCTCAAACCAGATGTTCCACGCCGCCGAAGCTTTCCT...

CDS

Download CDS FASTA

1419 bp · LXL04_024606|LXL04_024606|OH1004|CDS

ATGGCGGCGACTCGTCGTGAAATTTTCCCGGTGACGCCGACGCTGTTGTCGCTGGTGGCGGCTTATGCCCCACAGTACACCCATGTCTTGCTCTTTCTTGTCTCAACGTTTAACCTCTCCCCTGAACTCCTATACAATATCTTCGCCGCCGTCCGACGCTACTGGAAACCTATTCCTAAATCCACAAAACTCACTCTCGTCTTCAAAGAGAAAGACGGCCTGGTCTCAAACCAGATGTTCCACGCCGCCGAAGCTTTCCT...

Protein

Download Protein FASTA

472 aa · LXL04_024606|LXL04_024606|OH1004|PROTEIN

MAATRREIFPVTPTLLSLVAAYAPQYTHVLLFLVSTFNLSPELLYNIFAAVRRYWKPIPKSTKLTLVFKEKDGLVSNQMFHAAEAFLGTKVNPNSRRLRITKSVKEDSINVKFAKSEAIVDSFEGMSLAWRYVIVEGKQKGPRVGGVKPEKKYIELVFEKEHKETVIKSYLPWILEKSKELEAQKKVVKLHNLQWPCTKKESVNLDHPSTFDTLALEPEMKKTITDDLDLFLRRRDFYKKVGKVWKRGYLLYGPPGTGKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024606`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024606

Location Chr05:95066656-95068239 (-)

Description Similar to At5g17730: AAA-ATPase At5g17730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17730`	AAA-ATPase At5g17730.	No verified direct reference in this release
`At5g17760`	AAA-ATPase At5g17760.	No verified direct reference in this release
`At2g18193`	AAA-ATPase At2g18193.	No verified direct reference in this release
`At2g18190`	AAA-ATPase At2g18190.	No verified direct reference in this release
`At3g50940`	AAA-ATPase At3g50940.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024606 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT2G18190

ath:AT2G18193

ath:AT3G50940

ath:AT5G17730

ath:AT5G17760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.387

Rank 1 · LXL04_024606 · OH-1004

Nucleus0.278

Rank 2 · LXL04_024606 · OH-1004

Mitochondrion0.149

Rank 3 · LXL04_024606 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_024606 · OH-1004

Plastid0.081

Rank 5 · LXL04_024606 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14363.12AAA_assoc52-133 aa

PF00004.36AAA249-385 aa

PF25568.1AAA_lid_At3g28540388-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024606	`PF14363.12`	AAA_assoc	52	133	2e-16	60.9
LXL04_024606	`PF00004.36`	AAA	249	385	3.7e-19	70.2
LXL04_024606	`PF25568.1`	AAA_lid_At3g28540	388	457	2.6e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN78`	Arabidopsis thaliana	AAA-ATPase At5g17730	45.770%	Swiss-Prot	moderate database homology
`Q9FN75`	Arabidopsis thaliana	AAA-ATPase At5g17760	45.992%	Swiss-Prot	moderate database homology
`Q8GW96`	Arabidopsis thaliana	AAA-ATPase At2g18193	46.608%	Swiss-Prot	moderate database homology
`F4IQG2`	Arabidopsis thaliana	AAA-ATPase At2g18190	48.026%	Swiss-Prot	moderate database homology
`Q147F9`	Arabidopsis thaliana	AAA-ATPase At3g50940	50.123%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card