LXL04_024549 | RubberDandelionOmics

Gene overview

LXL04_024549

Reference: OH-1004 Chr: Chr05 Coordinates: 93595992-93597047 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · LXL04_024549|LXL04_024549|OH1004|cDNA

ATGGCGAAATTTAAGCTACGGATCTTTCAATCTTGCCGATCAAAAGACCCTTCTAGTCTGCCGGAGCATCCTGTTCCGGCTTTTCAACGTCATAATATCTTTGCCGGTGATTCCCCGCCGACAACCACACCGCCGCCTTCCAAACAACAGGCACATCGTTCTTCGTTCAAAAGCCACGTCTCCTCCGCCTTCGGCTGCGGCTCCAAATCCGGAGACCAGTCAGACTCTGAGTACTTCCAGTGGCAAGAAGACGAGCAATG...

CDS

Download CDS FASTA

1056 bp · LXL04_024549|LXL04_024549|OH1004|CDS

ATGGCGAAATTTAAGCTACGGATCTTTCAATCTTGCCGATCAAAAGACCCTTCTAGTCTGCCGGAGCATCCTGTTCCGGCTTTTCAACGTCATAATATCTTTGCCGGTGATTCCCCGCCGACAACCACACCGCCGCCTTCCAAACAACAGGCACATCGTTCTTCGTTCAAAAGCCACGTCTCCTCCGCCTTCGGCTGCGGCTCCAAATCCGGAGACCAGTCAGACTCTGAGTACTTCCAGTGGCAAGAAGACGAGCAATG...

Protein

Download Protein FASTA

351 aa · LXL04_024549|LXL04_024549|OH1004|PROTEIN

MAKFKLRIFQSCRSKDPSSLPEHPVPAFQRHNIFAGDSPPTTTPPPSKQQAHRSSFKSHVSSAFGCGSKSGDQSDSEYFQWQEDEQWHVVAKIYDVESPRRKIYNSSVSGGDTDDDRFPLPLLPLPPVDKKKRRRGRRAKINRLRNISTSSGDSGLFSSEYSIQEVCEVEALGDGGGDGEEDETETLISSSRSFSTDSSTDFNPQLETIRECAPISLSHRHKLNKKRISSSKRNSRGHGNSGGGMMMMMCRGSSGMSPEW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024549`
TK1151 ID	TkA06G131980
OH-1004 ID	LXL04_024549
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024549

Location Chr05:93595992-93597047 (+)

Description Similar to OFP7: Transcription repressor OFP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18500`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release
`At5g19650`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development.2011 · DOI: 10.1371/journal.pone.0023896
`At3g52525`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release
`At5g58360`	Transcriptional repressor that may regulate multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release
`At2g30400`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024549 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G18500

ath:AT2G30400

ath:AT3G52525

ath:AT5G19650

ath:AT5G58360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.393

Rank 1 · LXL04_024549 · OH-1004

Nucleus0.392

Rank 2 · LXL04_024549 · OH-1004

Cytoplasm0.373

Rank 3 · LXL04_024549 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_024549 · OH-1004

Plastid0.045

Rank 5 · LXL04_024549 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04844.19Ovate291-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024549	`PF04844.19`	Ovate	291	347	2.3e-24	85.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU65`	Arabidopsis thaliana	Transcription repressor OFP7	35.422%	Swiss-Prot	moderate database homology
`Q3E9B4`	Arabidopsis thaliana	Transcription repressor OFP8	64.179%	Swiss-Prot	weak database homology
`Q3EAL1`	Arabidopsis thaliana	Transcription repressor OFP6	59.677%	Swiss-Prot	weak database homology
`Q9LVL4`	Arabidopsis thaliana	Transcription repressor OFP3	56.452%	Swiss-Prot	weak database homology
`O04351`	Arabidopsis thaliana	Transcription repressor OFP2	51.613%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card