LXL04_024535 | RubberDandelionOmics

Gene overview

LXL04_024535

Reference: OH-1004 Chr: Chr05 Coordinates: 93228817-93232198 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1899 bp · LXL04_024535|LXL04_024535|OH1004|cDNA

ATGGCGGATATTCTCGCTTCTTTGCGATCCTTAATGGCTTCACATACTCCACCTCTCGATGCCCTAGTTGTTCCATCTGAAGATTATCACCAGAGCGAGTATGTATCTGCTAGAGACAAGAGGCGCGCGTTCGTTTCTGGATTTACTGGAAGTGCTGGTTTGGCACTTATAACAAAGAATGAAGCACTCCTTTGGACGGATGGAAGATACTTCTTGCAGGCAGAACAACAACTAAGTAACCAATGGAGGCTTATGCGTAT...

CDS

Download CDS FASTA

1899 bp · LXL04_024535|LXL04_024535|OH1004|CDS

ATGGCGGATATTCTCGCTTCTTTGCGATCCTTAATGGCTTCACATACTCCACCTCTCGATGCCCTAGTTGTTCCATCTGAAGATTATCACCAGAGCGAGTATGTATCTGCTAGAGACAAGAGGCGCGCGTTCGTTTCTGGATTTACTGGAAGTGCTGGTTTGGCACTTATAACAAAGAATGAAGCACTCCTTTGGACGGATGGAAGATACTTCTTGCAGGCAGAACAACAACTAAGTAACCAATGGAGGCTTATGCGTAT...

Protein

Download Protein FASTA

632 aa · LXL04_024535|LXL04_024535|OH1004|PROTEIN

MADILASLRSLMASHTPPLDALVVPSEDYHQSEYVSARDKRRAFVSGFTGSAGLALITKNEALLWTDGRYFLQAEQQLSNQWRLMRMGEDPSVDSWISINLPQDSSIGIDFWCISVDNAQKWRSVLAKKQQKLVPTTKNLVDEVWKDQPKAETNPVHVHPLKFSGRSVSDKLKDLRDNLKKEKARGIIITTLDEVVWLYNVRGGDVSYSPVVHSFAVVTTSSAFFYVDERKLSSEVKSYLKENNITVKDYSSVSSDVGLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024535`
TK1151 ID	TkA06G133960
OH-1004 ID	LXL04_024535
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024535

Location Chr05:93228817-93232198 (-)

Description Similar to APP1: Aminopeptidase P1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36760`	Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro (By similarity).	Identification, purification, and molecular cloning of N-1-naphthylphthalmic acid-binding plasma membrane-associated aminopeptidases from Arabidopsis.2002 · DOI: 10.1104/pp.010519
`At3g05350`	Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009877 nodulation Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0019897 extrinsic component of plasma membrane Cellular Component

GO:0004177 aminopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05350

ath:AT4G36760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.788

Rank 1 · LXL04_024535 · OH-1004

Nucleus0.371

Rank 2 · LXL04_024535 · OH-1004

Mitochondrion0.068

Rank 3 · LXL04_024535 · OH-1004

Peroxisome0.062

Rank 4 · LXL04_024535 · OH-1004

Cell membrane0.028

Rank 5 · LXL04_024535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01321.25Creatinase_N6-138 aa

PF16189.12Creatinase_N_2147-318 aa

PF00557.30Peptidase_M24321-558 aa

PF16188.11Peptidase_M24_C569-629 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024535	`PF01321.25`	Creatinase_N	6	138	1.8e-17	64.7
LXL04_024535	`PF16189.12`	Creatinase_N_2	147	318	2.4e-47	161.7
LXL04_024535	`PF00557.30`	Peptidase_M24	321	558	3.9e-49	168.0
LXL04_024535	`PF16188.11`	Peptidase_M24_C	569	629	2.9e-25	88.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JQH3`	Arabidopsis thaliana	Aminopeptidase P1	68.118%	Swiss-Prot	strong database homology
`Q8RY11`	Arabidopsis thaliana	Aminopeptidase P2	43.865%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card