LXL04_024486 | RubberDandelionOmics

Gene overview

LXL04_024486

Reference: OH-1004 Chr: Chr05 Coordinates: 91909705-91910968 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_024486|LXL04_024486|OH1004|cDNA

ATGGACACTACCCAAGTTCCTACAAACGATGGCCAATCTTTATTGATTCCGCCGGAAAGTAGGCCGACGTCCATGACGCTGACCAATGAAGCAATTGATGATAAAATGGACGTGAATGGATTTCTCGCTTCTTCAAACTCCATTAACATTGCCGACCTGGGGTACTCAGATGGATTCCTGGCCGTTAAAAACATCGTTGAATCTGTGAAACGGAAAGGTTCCGACGAAGAGATTCAGTTTCAAGTGTTCTTCAACGACCA...

CDS

Download CDS FASTA

1023 bp · LXL04_024486|LXL04_024486|OH1004|CDS

ATGGACACTACCCAAGTTCCTACAAACGATGGCCAATCTTTATTGATTCCGCCGGAAAGTAGGCCGACGTCCATGACGCTGACCAATGAAGCAATTGATGATAAAATGGACGTGAATGGATTTCTCGCTTCTTCAAACTCCATTAACATTGCCGACCTGGGGTACTCAGATGGATTCCTGGCCGTTAAAAACATCGTTGAATCTGTGAAACGGAAAGGTTCCGACGAAGAGATTCAGTTTCAAGTGTTCTTCAACGACCA...

Protein

Download Protein FASTA

340 aa · LXL04_024486|LXL04_024486|OH1004|PROTEIN

MDTTQVPTNDGQSLLIPPESRPTSMTLTNEAIDDKMDVNGFLASSNSINIADLGYSDGFLAVKNIVESVKRKGSDEEIQFQVFFNDHVFNHFDKLLKFVPPNRECYAAIVSGSIHSRLFPKGALHFVNSSYALYWLSKIPDELIDKNSPAFNKGKIFYTTSHKEVVEAYSAQFRKDMAAFLNARAEELVPGGLMSLVLPCFEVKKHPLVDVVDLLGDCLIDLVNAGLVSEDKVDSFNFPRYNATREEIKNVINENGQFRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024486`
TK1151 ID	TkA06G138770
OH-1004 ID	LXL04_024486
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024486

Location Chr05:91909705-91910968 (-)

Description Similar to LAMT: Loganic acid O-methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38100`	Probable S-adenosylmethionine-dependent methyltransferase At5g38100.	No verified direct reference in this release
`At5g37970`	Probable S-adenosylmethionine-dependent methyltransferase At5g37970.	No verified direct reference in this release
`At5g37990`	Probable S-adenosylmethionine-dependent methyltransferase At5g37990.	No verified direct reference in this release
`At5g38780`	Probable S-adenosylmethionine-dependent methyltransferase At5g38780.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024486 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0035834 indole alkaloid metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0030749 loganate O-methyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ag:ABW38009

ath:AT5G37970

ath:AT5G37990

ath:AT5G38100

ath:AT5G38780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.785

Rank 1 · LXL04_024486 · OH-1004

Nucleus0.285

Rank 2 · LXL04_024486 · OH-1004

Endoplasmic reticulum0.064

Rank 3 · LXL04_024486 · OH-1004

Plastid0.044

Rank 4 · LXL04_024486 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_024486 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03492.23Methyltransf_725-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024486	`PF03492.23`	Methyltransf_7	25	338	7.5e-81	272.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS10`	Arabidopsis thaliana	Probable S-adenosylmethionine-dependent methyltransferase At5g38100	37.576%	Swiss-Prot	moderate database homology
`Q9FKD0`	Arabidopsis thaliana	Probable S-adenosylmethionine-dependent methyltransferase At5g37970	37.160%	Swiss-Prot	moderate database homology
`Q9FKC8`	Arabidopsis thaliana	Probable S-adenosylmethionine-dependent methyltransferase At5g37990	38.182%	Swiss-Prot	moderate database homology
`Q9FKR0`	Arabidopsis thaliana	Probable S-adenosylmethionine-dependent methyltransferase At5g38780	36.949%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card