LXL04_024464 | RubberDandelionOmics

Gene overview

LXL04_024464

Reference: OH-1004 Chr: Chr05 Coordinates: 91412632-91413627 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_024464|LXL04_024464|OH1004|cDNA

ATGAGAGCAAGTAGTAAAATGGGTTTAGGGTTGAGGAAAGGTGCATGGACTGCCGACGAAGATATTCTTCTGAAAAACTATATTGAGAAATACGGCGAAGGGAAATGGCATCTCGTTCCTCTAAAATCAGGGTTAAACAGGTGCAGGAAGAGTTGTAGGCTAAGATGGTTAAATTATTTGAGACCAAACATAAAAAGAGGAAACTTTGGTGAAGATGAAGTTGATCTCATACTTAGGCTTCATAAGCTATTAGGAAACAG...

CDS

Download CDS FASTA

738 bp · LXL04_024464|LXL04_024464|OH1004|CDS

ATGAGAGCAAGTAGTAAAATGGGTTTAGGGTTGAGGAAAGGTGCATGGACTGCCGACGAAGATATTCTTCTGAAAAACTATATTGAGAAATACGGCGAAGGGAAATGGCATCTCGTTCCTCTAAAATCAGGGTTAAACAGGTGCAGGAAGAGTTGTAGGCTAAGATGGTTAAATTATTTGAGACCAAACATAAAAAGAGGAAACTTTGGTGAAGATGAAGTTGATCTCATACTTAGGCTTCATAAGCTATTAGGAAACAG...

Protein

Download Protein FASTA

245 aa · LXL04_024464|LXL04_024464|OH1004|PROTEIN

MRASSKMGLGLRKGAWTADEDILLKNYIEKYGEGKWHLVPLKSGLNRCRKSCRLRWLNYLRPNIKRGNFGEDEVDLILRLHKLLGNRWSLIAGRIPGRTANDVKNYWNTYLRLSSKQQKKIPNGDKSLQDMRVTIFKPEPRSYSKTLKKCMGDYPYIVTHDGDNIRNECADNLNIKSSGLITPSNLVFDHDNVDEFFDSLLVDGKQIDGNFGWSLDGVEEEDDHIRLFNFPLDEVTCDFINFSQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024464`
TK1151 ID	TkA06G140720
OH-1004 ID	LXL04_024464
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024464

Location Chr05:91412632-91413627 (+)

Description Similar to MYB1: Transcription factor MYB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66370`	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8.	No verified direct reference in this release
`At1g66390`	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3.	No verified direct reference in this release
`At1g56650`	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3.	Sucrose-specific induction of anthocyanin biosynthesis in Arabidopsis requires the MYB75/PAP1 gene.2005 · DOI: 10.1104/pp.105.066688

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024464 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009745 sucrose mediated signaling Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0019430 removal of superoxide radicals Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0031542 positive regulation of anthocyanin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G56650

ath:AT1G66370

ath:AT1G66390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · LXL04_024464 · OH-1004

Cytoplasm0.150

Rank 2 · LXL04_024464 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_024464 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_024464 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_024464 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding13-60 aa

PF13921.13Myb_DNA-bind_616-73 aa

PF00249.38Myb_DNA-binding66-111 aa

PF13921.13Myb_DNA-bind_671-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024464	`PF00249.38`	Myb_DNA-binding	13	60	1.4e-34	118.7
LXL04_024464	`PF13921.13`	Myb_DNA-bind_6	16	73	8.5e-20	71.4
LXL04_024464	`PF00249.38`	Myb_DNA-binding	66	111	1.4e-34	118.7
LXL04_024464	`PF13921.13`	Myb_DNA-bind_6	71	115	8.5e-20	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNV9`	Arabidopsis thaliana	Transcription factor MYB113	64.085%	Swiss-Prot	moderate database homology
`Q9ZTC3`	Arabidopsis thaliana	Transcription factor MYB90	63.399%	Swiss-Prot	moderate database homology
`Q9FE25`	Arabidopsis thaliana	Transcription factor MYB75	62.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card