LXL04_024414 | RubberDandelionOmics

Gene overview

LXL04_024414

Reference: OH-1004 Chr: Chr05 Coordinates: 89988643-89989824 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

936 bp · LXL04_024414|LXL04_024414|OH1004|cDNA

ATGTCAGATTTTGGTGAAACCCCCAATAACAACTGGAAGATTCAAGGATCTGGGTTCTTGAACCAGAAAAGATCTAACCCATACCCACATCATGATCACCAACCCTTAAAAGCTGCCCGACCCGACCCATACAACAACACAATGTCCATAAATACAGGAACCTTCACACATTCTCAGTGGATGGAGCTCGAACTCCATGCTTTGATCTACAAACATATTGTCGCAAATGTGCCTGTTCCTTCGATTTTGATAAATCACGT...

CDS

Download CDS FASTA

936 bp · LXL04_024414|LXL04_024414|OH1004|CDS

ATGTCAGATTTTGGTGAAACCCCCAATAACAACTGGAAGATTCAAGGATCTGGGTTCTTGAACCAGAAAAGATCTAACCCATACCCACATCATGATCACCAACCCTTAAAAGCTGCCCGACCCGACCCATACAACAACACAATGTCCATAAATACAGGAACCTTCACACATTCTCAGTGGATGGAGCTCGAACTCCATGCTTTGATCTACAAACATATTGTCGCAAATGTGCCTGTTCCTTCGATTTTGATAAATCACGT...

Protein

Download Protein FASTA

311 aa · LXL04_024414|LXL04_024414|OH1004|PROTEIN

MSDFGETPNNNWKIQGSGFLNQKRSNPYPHHDHQPLKAARPDPYNNTMSINTGTFTHSQWMELELHALIYKHIVANVPVPSILINHVKKSLDPFVFFGSSSTSNAPNLHGWGLGGFRLGFPASNDPEPGRCRRTDGKKWRCSKEAVPDQKYCEKHINRGRHRSRKLVEDKNGGRGGGGGGGINNHVKNLQFQNIRPEEDRSDWTQLTMSMDSSDFSSSAISLAQEKLTIAQNEASDSIPDSWQRSTGGPLGEALKTSSSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024414`
TK1151 ID	TkA06G146160
OH-1004 ID	LXL04_024414
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 94.534 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024414

Location Chr05:89988643-89989824 (-)

Description Similar to GRF2: Growth-regulating factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37740`	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues.	No verified direct reference in this release
`At2g22840`	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0484900`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release
`Os03g0729500`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release
`Os11g0551900`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024414 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009409 response to cold Biological Process

GO:0009624 response to nematode Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0032502 developmental process Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G22840

ath:AT4G37740

dosa:Os03g0729500

dosa:Os11g0551900

dosa:Os12g0484900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_024414 · OH-1004

Cytoplasm0.087

Rank 2 · LXL04_024414 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_024414 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_024414 · OH-1004

Plastid0.014

Rank 5 · LXL04_024414 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08880.17QLQ55-86 aa

PF08879.16WRC126-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024414	`PF08880.17`	QLQ	55	86	4.3e-09	36.6
LXL04_024414	`PF08879.16`	WRC	126	168	2.8e-21	75.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8A8`	Arabidopsis thaliana	Growth-regulating factor 2	63.636%	Swiss-Prot	weak database homology
`O81001`	Arabidopsis thaliana	Growth-regulating factor 1	60.769%	Swiss-Prot	weak database homology
`Q6AWY2`	Oryza sativa subsp. japonica	Growth-regulating factor 7	64.103%	Swiss-Prot	weak database homology
`Q6AWY3`	Oryza sativa subsp. japonica	Growth-regulating factor 6	57.364%	Swiss-Prot	weak database homology
`Q6AWY1`	Oryza sativa subsp. japonica	Growth-regulating factor 8	56.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card