LXL04_024404 | RubberDandelionOmics

Gene overview

LXL04_024404

Reference: OH-1004 Chr: Chr05 Coordinates: 89700712-89702292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_024404|LXL04_024404|OH1004|cDNA

ATGGGTTTATGGGAAGTTTTTCTCAATTGGCTTCGAAGCCTCTTTTTCAAGCAAGAAATGGAGCTCTCTCTAATAGGCCTCCAAAATGCTGGGAAAACTTCACTTGTTAATGTTGTCGCTACTGGTGGATATAGTGAAGATATGATCCCTACGGTTGGATTTAACATGCGTAAAGTAACTAAAGGAAATGTAACAATAAAGTTATGGGATCTTGGTGGTCAACCACGGTTTCGCAGTATGTGGGAAAGATATTGTCGTGC...

CDS

Download CDS FASTA

555 bp · LXL04_024404|LXL04_024404|OH1004|CDS

ATGGGTTTATGGGAAGTTTTTCTCAATTGGCTTCGAAGCCTCTTTTTCAAGCAAGAAATGGAGCTCTCTCTAATAGGCCTCCAAAATGCTGGGAAAACTTCACTTGTTAATGTTGTCGCTACTGGTGGATATAGTGAAGATATGATCCCTACGGTTGGATTTAACATGCGTAAAGTAACTAAAGGAAATGTAACAATAAAGTTATGGGATCTTGGTGGTCAACCACGGTTTCGCAGTATGTGGGAAAGATATTGTCGTGC...

Protein

Download Protein FASTA

184 aa · LXL04_024404|LXL04_024404|OH1004|PROTEIN

MGLWEVFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLNISKSELHDLLSKPSLNGIPLLVLGNKIDKDGALSKQSLTDQMDLKSITDREVCCYMISCKNSTNIDSVIDWLIKHSKSKT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024404`
TK1151 ID	TkA06G147140
OH-1004 ID	LXL04_024404
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024404

Location Chr05:89700712-89702292 (+)

Description Similar to ARL8A: ADP-ribosylation factor-like protein 8a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49870`	May play a role in lysosome motility.	No verified direct reference in this release
`At5g67560`	May play a role in lysosome motility.	No verified direct reference in this release
`At5g37680`	May play a role in lysosome motility.	No verified direct reference in this release
`At3g49860`	May play a role in lysosome motility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0015031 protein transport Biological Process

GO:0051301 cell division Biological Process

GO:0051607 defense response to virus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005819 spindle Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G49860

ath:AT3G49870

ath:AT5G37680

ath:AT5G67560

gga:421175

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.397

Rank 1 · LXL04_024404 · OH-1004

Golgi apparatus0.346

Rank 2 · LXL04_024404 · OH-1004

Lysosome / Vacuole0.199

Rank 3 · LXL04_024404 · OH-1004

Endoplasmic reticulum0.194

Rank 4 · LXL04_024404 · OH-1004

Cell membrane0.156

Rank 5 · LXL04_024404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf9-178 aa

PF08477.20Roc22-132 aa

PF09439.17SRPRB22-146 aa

PF00071.29Ras23-179 aa

PF01926.30MMR_HSR123-130 aa

PF04670.19Gtr1_RagA24-146 aa

PF00503.27G-alpha49-131 aa

PF00009.34GTP_EFTU55-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024404	`PF00025.28`	Arf	9	178	1e-45	156.1
LXL04_024404	`PF08477.20`	Roc	22	132	7.1e-16	59.2
LXL04_024404	`PF09439.17`	SRPRB	22	146	1.5e-07	31.7
LXL04_024404	`PF00071.29`	Ras	23	179	6.9e-17	62.2
LXL04_024404	`PF01926.30`	MMR_HSR1	23	130	2.5e-07	31.5
LXL04_024404	`PF04670.19`	Gtr1_RagA	24	146	2.2e-09	37.8
LXL04_024404	`PF00503.27`	G-alpha	49	131	5.4e-06	26.5
LXL04_024404	`PF00009.34`	GTP_EFTU	55	180	8.7e-06	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY57`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8a	91.803%	Swiss-Prot	strong database homology
`Q93Y31`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8b	90.659%	Swiss-Prot	strong database homology
`Q8W4C8`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8c	82.065%	Swiss-Prot	strong database homology
`F4IZ82`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8d	78.916%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card