LXL04_024334 | RubberDandelionOmics

Gene overview

LXL04_024334

Reference: OH-1004 Chr: Chr05 Coordinates: 87639673-87642112 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_024334|LXL04_024334|OH1004|cDNA

ATGTCGATAGTTTCCTCAAGGAAATTGATGTGTGCAAGGGTTTTGGGTGGATTTAGATATGGGTGTTGGAACTTGAAGCAGAGTGAAGAAGATCCGGCGACCATGGATGAGTGTCTCTTAAGCATATCGAAGCGAACAGAATTAAAAATGCACTTTTATGTGATTTATTGCAATTTCTGGGAGTTGGACACGGATCATGATTTCTTGATAGATAAAGAGAACCTTATAAGATATGATAATCATGCACTCACTTACAGAAT...

CDS

Download CDS FASTA

486 bp · LXL04_024334|LXL04_024334|OH1004|CDS

ATGTCGATAGTTTCCTCAAGGAAATTGATGTGTGCAAGGGTTTTGGGTGGATTTAGATATGGGTGTTGGAACTTGAAGCAGAGTGAAGAAGATCCGGCGACCATGGATGAGTGTCTCTTAAGCATATCGAAGCGAACAGAATTAAAAATGCACTTTTATGTGATTTATTGCAATTTCTGGGAGTTGGACACGGATCATGATTTCTTGATAGATAAAGAGAACCTTATAAGATATGATAATCATGCACTCACTTACAGAAT...

Protein

Download Protein FASTA

161 aa · LXL04_024334|LXL04_024334|OH1004|PROTEIN

MSIVSSRKLMCARVLGGFRYGCWNLKQSEEDPATMDECLLSISKRTELKMHFYVIYCNFWELDTDHDFLIDKENLIRYDNHALTYRIADRISSQVPIKFTINVEGKWDMKTLFISLCQKRTNHENQVSNTGTHLPTYSDLEVSNGMCTPYFKISRNFKTIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024334`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024334

Location Chr05:87639673-87642112 (-)

Description Similar to B''DELTA: Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54450`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At5g44090`	Regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At5g28850`	Regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At5g28900`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At1g03960`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024334 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0019888 protein phosphatase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G03960

ath:AT1G54450

ath:AT5G28850

ath:AT5G28900

ath:AT5G44090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.346

Rank 1 · LXL04_024334 · OH-1004

Mitochondrion0.283

Rank 2 · LXL04_024334 · OH-1004

Nucleus0.256

Rank 3 · LXL04_024334 · OH-1004

Cell membrane0.091

Rank 4 · LXL04_024334 · OH-1004

Endoplasmic reticulum0.083

Rank 5 · LXL04_024334 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLI8`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta	85.714%	Swiss-Prot	weak database homology
`Q9XGR4`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A regulatory subunit B''alpha	83.929%	Swiss-Prot	weak database homology
`Q5QIT3`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A regulatory subunit B''beta	83.929%	Swiss-Prot	weak database homology
`Q8VZQ4`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma	83.929%	Swiss-Prot	weak database homology
`Q84JI6`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''epsilon	75.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card