LXL04_024299 | RubberDandelionOmics

Gene overview

LXL04_024299

Reference: OH-1004 Chr: Chr05 Coordinates: 86739548-86744109 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_024299|LXL04_024299|OH1004|cDNA

ATGAATATTGATCGGCCGACCATGGTGGGGAATCTGGTGGTGGACATGCCGATCATGCACGACAGTGACCGGTACGATTTTGTTCGGGATATCGGGTCGGGTAATTTCGGGGTAGCAAGGCTTATGAGAGATAAGCAGACCACAGAGCTTGTTGCAGTTAAGTATATCGAGAGAGGGGAAAAgaTAGATGAAAATGTTCAAAGAGAGATTATTAATCATAGGCCTTTGAGACATCCTAATATCGTCCGGTTTAAAGAGGT...

CDS

Download CDS FASTA

1110 bp · LXL04_024299|LXL04_024299|OH1004|CDS

ATGAATATTGATCGGCCGACCATGGTGGGGAATCTGGTGGTGGACATGCCGATCATGCACGACAGTGACCGGTACGATTTTGTTCGGGATATCGGGTCGGGTAATTTCGGGGTAGCAAGGCTTATGAGAGATAAGCAGACCACAGAGCTTGTTGCAGTTAAGTATATCGAGAGAGGGGAAAAGATAGATGAAAATGTTCAAAGAGAGATTATTAATCATAGGCCTTTGAGACATCCTAATATCGTCCGGTTTAAAGAGGT...

Protein

Download Protein FASTA

369 aa · LXL04_024299|LXL04_024299|OH1004|PROTEIN

MNIDRPTMVGNLVVDMPIMHDSDRYDFVRDIGSGNFGVARLMRDKQTTELVAVKYIERGEKIDENVQREIINHRPLRHPNIVRFKEVILTPTHLAIVMEYVSGGELFDRICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSLAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLARQEYDGKIADVWSCGVTLYVMLVGGYPFEDPNEPRDFRKTIHRILEVQYSIPENIEISPECRHLLSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024299`
TK1151 ID	TkA06G155750
OH-1004 ID	LXL04_024299
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024299

Location Chr05:86739548-86744109 (-)

Description Similar to SRK2E: Serine/threonine-protein kinase SRK2E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33950`	May activate ABA signaling and participate in stomatal closure under drought, darkness and high CO₂.	Use of infrared thermal imaging to isolate Arabidopsis mutants defective in stomatal regulation.2002 · DOI: 10.1046/j.1365-313x.2002.01322.x Arabidopsis OST1 protein kinase mediates the regulation of stomatal aperture by abscisic acid and acts upstream of reactive oxygen species production.2002 · DOI: 10.1105/tpc.007906 ABA-activated SnRK2 protein kinase is required for dehydration stress signaling in Arabidopsis.2002 · DOI: 10.1093/pcp/pcf188 Cytoplasmic alkalization precedes reactive oxygen species production during methyl jasmonate- and abscisic acid-induced stomatal closure.2004 · DOI: 10.1104/pp.103.032250 The regulatory domain of SRK2E/OST1/SnRK2.6 interacts with ABI1 and integrates abscisic acid (ABA) and osmotic stress signals controlling stomatal closure in Arabidopsis.2006 · DOI: 10.1074/jbc.m509820200 The identification of genes involved in the stomatal response to reduced atmospheric relative humidity.2006 · DOI: 10.1016/j.cub.2006.03.028 Identification of features regulating OST1 kinase activity and OST1 function in guard cells.2006 · DOI: 10.1104/pp.106.079327 Plant stomata function in innate immunity against bacterial invasion.2006 · DOI: 10.1016/j.cell.2006.06.054 Ozone-triggered rapid stomatal response involves the production of reactive oxygen species, and is controlled by SLAC1 and OST1.2010 · DOI: 10.1111/j.1365-313x.2010.04159.x
`At5g66880`	Together with SRK2D, key component and activator of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as seed germination, Pro accumulation, root growth inhibition, dormancy and seedling growth, and, to a lesser extent, stomatal closure.	Identification of two protein kinases required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048538
`At3g50500`	Together with SRK2I, key component and activator of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as seed germination, Pro accumulation, root growth inhibition, dormancy and seedling growth, and, to a lesser extent, stomatal closure.	Identification of two protein kinases required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048538

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0764800`	May play a role in signal transduction of hyperosmotic response (Probable).	ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154
`Os03g0610900`	May play a role in signal transduction of hyperosmotic response.	ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024299 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT3G50500

ath:AT4G33950

ath:AT5G66880

dosa:Os03g0610900

dosa:Os03g0764800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.590

Rank 1 · LXL04_024299 · OH-1004

Nucleus0.464

Rank 2 · LXL04_024299 · OH-1004

Cell membrane0.139

Rank 3 · LXL04_024299 · OH-1004

Lysosome / Vacuole0.052

Rank 4 · LXL04_024299 · OH-1004

Mitochondrion0.050

Rank 5 · LXL04_024299 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase25-280 aa

PF07714.24PK_Tyr_Ser-Thr27-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024299	`PF00069.32`	Pkinase	25	280	1.8e-72	244.6
LXL04_024299	`PF07714.24`	PK_Tyr_Ser-Thr	27	277	4.2e-33	115.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940H6`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2E	77.353%	Swiss-Prot	strong database homology
`Q39193`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2I	75.410%	Swiss-Prot	strong database homology
`Q39192`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2D	75.698%	Swiss-Prot	strong database homology
`Q7Y0B9`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK8	79.193%	Swiss-Prot	strong database homology
`Q75H77`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK10	77.778%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card