LXL04_024269 | RubberDandelionOmics

Gene overview

LXL04_024269

Reference: OH-1004 Chr: Chr05 Coordinates: 86245388-86247080 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

898 bp · LXL04_024269|LXL04_024269|OH1004|cDNA

CAGCAAGCATCACAATTCACACGTTAGACGTTACTCAAGTCCGCATTTCTCCGATCATTTTGTAGTTTTCCGGTTCGGTATTTCAAAATTCCGGTCACTGCAGAAGAACTGGATGGCCCGAGTTGCTTCAAACCCCGTCGGTCTTCATAAATTTCAACCTTCTTGTTTTCATTCAGCTACAAAATCTCTTCATTTCGTAAATCCCTCCGTTCATTCCCGCAATAGAAAGCTCAGATTCCAGAGGTTGTACTGCCAATCTG...

CDS

Download CDS FASTA

801 bp · LXL04_024269|LXL04_024269|OH1004|CDS

CTGCAGAAGAACTGGATGGCCCGAGTTGCTTCAAACCCCGTCGGTCTTCATAAATTTCAACCTTCTTGTTTTCATTCAGCTACAAAATCTCTTCATTTCGTAAATCCCTCCGTTCATTCCCGCAATAGAAAGCTCAGATTCCAGAGGTTGTACTGCCAATCTGAACCTAAACCAACTGATTCTAACTCCGAGAAAAACCTGATTGCAGAATCTGATTCTGGTAAAGATGATAAGATTAGCGAAGCTTCAAATTCTCCAAA...

Protein

Download Protein FASTA

266 aa · LXL04_024269|LXL04_024269|OH1004|PROTEIN

MQKNWMARVASNPVGLHKFQPSCFHSATKSLHFVNPSVHSRNRKLRFQRLYCQSEPKPTDSNSEKNLIAESDSGKDDKISEASNSPNGDGLPNLPNKSLNRRIAIASVLGAVGLFVSGRLDFGVSLKDLSAAALSYEEALSNGKPTVVEFYADWCEVCRELAPDVYKVEQQYKDRVNFVMLNVDNTKWEQELDEFGVEGIPHFAFLDKNGNEEGNVVGKLPKKYFMENIDALATGKSSIPHARVVGQFSSAEARQVHRVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024269`
TK1151 ID	TkA06G157580
OH-1004 ID	LXL04_024269
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 63.158 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024269

Location Chr05:86245388-86247080 (+)

Description Similar to Os03g0767500: Thioredoxin-like protein HCF164, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37200`	Thiol-disulfide oxidoreductase that participates in various redox reactions in the chloroplast.	HCF164 encodes a thioredoxin-like protein involved in the biogenesis of the cytochrome b(6)f complex in Arabidopsis.2001 · DOI: 10.1105/tpc.010245

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0767500`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions in the chloroplast.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024269 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT4G37200

dosa:Os03g0767500

syf:Synpcc7942_1830

syf:Synpcc7942_2128

syn:sll1980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_024269 · OH-1004

Mitochondrion0.024

Rank 2 · LXL04_024269 · OH-1004

Nucleus0.020

Rank 3 · LXL04_024269 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_024269 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_024269 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin135-230 aa

PF13098.14Thioredoxin_2136-230 aa

PF13899.13Thioredoxin_7136-207 aa

PF08534.17Redoxin141-210 aa

PF13905.13Thioredoxin_8143-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024269	`PF00085.27`	Thioredoxin	135	230	7.9e-21	74.7
LXL04_024269	`PF13098.14`	Thioredoxin_2	136	230	8.1e-13	49.4
LXL04_024269	`PF13899.13`	Thioredoxin_7	136	207	2.6e-10	41.0
LXL04_024269	`PF08534.17`	Redoxin	141	210	2.1e-06	28.3
LXL04_024269	`PF13905.13`	Thioredoxin_8	143	189	2e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23166`	Arabidopsis thaliana	Thioredoxin-like protein HCF164, chloroplastic	65.044%	Swiss-Prot	strong database homology
`Q7Y0D4`	Oryza sativa subsp. japonica	Thioredoxin-like protein HCF164, chloroplastic	71.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card