RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_024224
Reference: OH-1004 Chr: Chr05 Coordinates: 85027153-85030802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1914 bp · LXL04_024224|LXL04_024224|OH1004|cDNA

ATGAGAGTGCAACGAAAGATTTCTGATTTCGTGTTCTTGATATGTTTCTTGTGGTTTTCTGGTTGTTCAAATGGCTTGCTTTCTCCTAAAGGTGTTAACTTTGAAGtGCAAGCGTTAATGGGTATAAAAGCTTCACTAATGGACCCTCATGGTGTTCTTGAGAATTGGGATGGTGATTCCGTTGATCCATGTAGTTGGACTATGGTTACTTGCTCTTCGGAATCTTTAGTCATTGGCTTAGGAACACCTTCGCAGAATCT...

CDS

Download CDS FASTA

1914 bp · LXL04_024224|LXL04_024224|OH1004|CDS

ATGAGAGTGCAACGAAAGATTTCTGATTTCGTGTTCTTGATATGTTTCTTGTGGTTTTCTGGTTGTTCAAATGGCTTGCTTTCTCCTAAAGGTGTTAACTTTGAAGTGCAAGCGTTAATGGGTATAAAAGCTTCACTAATGGACCCTCATGGTGTTCTTGAGAATTGGGATGGTGATTCCGTTGATCCATGTAGTTGGACTATGGTTACTTGCTCTTCGGAATCTTTAGTCATTGGCTTAGGAACACCTTCGCAGAATCT...

Protein

Download Protein FASTA

637 aa · LXL04_024224|LXL04_024224|OH1004|PROTEIN

MRVQRKISDFVFLICFLWFSGCSNGLLSPKGVNFEVQALMGIKASLMDPHGVLENWDGDSVDPCSWTMVTCSSESLVIGLGTPSQNLSGRLSPAIGNLTNLQIVLLQNNNITGPIPEEIGELKKLQTIDLSDNQFTNEIPSTLGHLTNLQYMRLNNNSLSGSIPQLIANMTQLAFVDLSFNNLSGPVPRFPSKTFNIVGNPLICGTGSEQECYGMTLMPMSMTLNTTQVDGTMPRPKSHKMALAISTSLGCISLLIFGLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_024224
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_024224
LocationChr05:85027153-85030802 (-)
DescriptionSimilar to NIK1: Protein NSP-INTERACTING KINASE 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g16000 May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.
Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.2008 · DOI: 10.1371/journal.ppat.1000247
NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171
CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354
At3g25560 Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS. No verified direct reference in this release
At2g23950 May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.
CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354
A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791
At1g60800 Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0274500 LRR receptor kinase that may be involved in defense response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024224 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0007639 homeostasis of number of meristem cells Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0010088 phloem development Biological Process
GO:0034504 protein localization to nucleus Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0040015 negative regulation of multicellular organism growth Biological Process
GO:0048638 regulation of developmental growth Biological Process
GO:0048653 anther development Biological Process
GO:0051607 defense response to virus Biological Process
GO:0140374 antiviral innate immune response Biological Process
KEGG gene cross-reference
ath:AT1G60800
ath:AT2G23950
ath:AT3G25560
ath:AT5G16000
dosa:Os06g0274500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884
Rank 1 · LXL04_024224 · OH-1004
Cytoplasm0.075
Rank 2 · LXL04_024224 · OH-1004
Endoplasmic reticulum0.075
Rank 3 · LXL04_024224 · OH-1004
Nucleus0.048
Rank 4 · LXL04_024224 · OH-1004
Lysosome / Vacuole0.021
Rank 5 · LXL04_024224 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_233-72 aa
PF23598.2LRR_1494-175 aa
PF13855.13LRR_896-135 aa
PF12799.14LRR_499-136 aa
PF13855.13LRR_8140-183 aa
PF12799.14LRR_4147-185 aa
PF00069.32Pkinase305-518 aa
PF07714.24PK_Tyr_Ser-Thr307-585 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_024224PF08263.18LRRNT_233721.1e-1455.1
LXL04_024224PF23598.2LRR_14941751.1e-1248.1
LXL04_024224PF13855.13LRR_8961351.7e-0938.0
LXL04_024224PF12799.14LRR_4991366.8e-1142.8
LXL04_024224PF13855.13LRR_81401831.7e-0938.0
LXL04_024224PF12799.14LRR_41471856.8e-1142.8
LXL04_024224PF00069.32Pkinase3055189.8e-42143.9
LXL04_024224PF07714.24PK_Tyr_Ser-Thr3075852.3e-41142.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LFS4Arabidopsis thalianaProtein CLAVATA3 INSENSITIVE RECEPTOR KINASE 574.303%Swiss-Protstrong database homology
Q8RY65Arabidopsis thalianaProtein CLAVATA3 INSENSITIVE RECEPTOR KINASE 670.569%Swiss-Protstrong database homology
Q0WVM4Arabidopsis thalianaProtein CLAVATA3 INSENSITIVE RECEPTOR KINASE 258.986%Swiss-Protstrong database homology
Q93ZS4Arabidopsis thalianaProtein CLAVATA3 INSENSITIVE RECEPTOR KINASE 160.502%Swiss-Protstrong database homology
Q9FP13Oryza sativa subsp. japonicaLRR receptor kinase SERL265.556%Swiss-Protstrong database homology

JBrowse

View in Genome Browser