LXL04_024198 | RubberDandelionOmics

Gene overview

LXL04_024198

Reference: OH-1004 Chr: Chr05 Coordinates: 84388701-84389957 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · LXL04_024198|LXL04_024198|OH1004|cDNA

ATGATTCAAGAACCTTCGCGACAGAGAGGTGCCGACGACGACGACGACGCTCCCCGCTCAGCTTCACTCCCCCGCTGCTACCTAGGGCACAACTACGGTTCGACCAGATTTCTCGGTCAAGCTACATTAACTATTTTTGCTCCTATGGATGAAGTGATGGTTGATTATTCCGGTAGGTTTCCGGATTACCAGTCTCTGATCTTGATATTAGTGAGGATGGTGAGAGTTAGTGTTCTGAATGACGCTCTTAAGAGCATGTA...

CDS

Download CDS FASTA

609 bp · LXL04_024198|LXL04_024198|OH1004|CDS

ATGATTCAAGAACCTTCGCGACAGAGAGGTGCCGACGACGACGACGACGCTCCCCGCTCAGCTTCACTCCCCCGCTGCTACCTAGGGCACAACTACGGTTCGACCAGATTTCTCGGTCAAGCTACATTAACTATTTTTGCTCCTATGGATGAAGTGATGGTTGATTATTCCGGTAGGTTTCCGGATTACCAGTCTCTGATCTTGATATTAGTGAGGATGGTGAGAGTTAGTGTTCTGAATGACGCTCTTAAGAGCATGTA...

Protein

Download Protein FASTA

202 aa · LXL04_024198|LXL04_024198|OH1004|PROTEIN

MIQEPSRQRGADDDDDAPRSASLPRCYLGHNYGSTRFLGQATLTIFAPMDEVMVDYSGRFPDYQSLILILVRMVRVSVLNDALKSMYNAVKRGKRQVMIRPSSKVIFKFLMVMQKHGYIGEFEYVDDHRSGKIVVELNGRMNKCGVISPRFDVGVKEIEPWTARLLPSRQFGHIVLTTSAGIMDHEEARRKNVGGKVLGFFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024198`
TK1151 ID	TkA06G165250
OH-1004 ID	LXL04_024198
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.356 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024198

Location Chr05:84388701-84389957 (+)

Description Similar to RPS15A: 40S ribosomal protein S15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P42798`	Small ribosomal subunit protein uS8z/uS8w.	No verified direct reference in this release
`At3g46040`	Small ribosomal subunit protein uS8x.	No verified direct reference in this release
`At2g39590`	Small ribosomal subunit protein uS8y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024198 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT1G07770

ath:AT2G39590

ath:AT3G46040

ath:AT5G59850

bna:106346392

bna:106362258

bna:106385644

bna:106386853

bna:106411630

bna:106411828

bna:106419513

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · LXL04_024198 · OH-1004

Nucleus0.281

Rank 2 · LXL04_024198 · OH-1004

Plastid0.257

Rank 3 · LXL04_024198 · OH-1004

Mitochondrion0.062

Rank 4 · LXL04_024198 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_024198 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00410.25Ribosomal_S879-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024198	`PF00410.25`	Ribosomal_S8	79	202	1e-20	74.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42798`	Arabidopsis thaliana	Small ribosomal subunit protein uS8z/uS8w	94.615%	Swiss-Prot	moderate database homology
`Q9LX88`	Arabidopsis thaliana	Small ribosomal subunit protein uS8x	93.846%	Swiss-Prot	moderate database homology
`O80646`	Arabidopsis thaliana	Small ribosomal subunit protein uS8y	87.692%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card