LXL04_024145 | RubberDandelionOmics

Gene overview

LXL04_024145

Reference: OH-1004 Chr: Chr05 Coordinates: 82286758-82287195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · LXL04_024145|LXL04_024145|OH1004|cDNA

ATGAATCTAGACGAGGTTAGTTTCTGGTACGGAAGAAGAAACGGGTGTAAAGGGAAAATGGGATTTGAGGAACGAACTCCATTAACGATCGCTGCCGTTTACCGAAGCACCGAGCTTTTGCTAGAGGCTTCCGCTGATCCAGATCTAATCGTAGGCATCGACTACAAACCGGTGGATCTGATTGCTCGTGGCATCAAATCTTCCAAACGGAAAGCTTTGGAGATGTTATTGAGGGGTTTTTCTGTAGAAGAAACCGAAGA...

CDS

Download CDS FASTA

315 bp · LXL04_024145|LXL04_024145|OH1004|CDS

ATGAATCTAGACGAGGTTAGTTTCTGGTACGGAAGAAGAAACGGGTGTAAAGGGAAAATGGGATTTGAGGAACGAACTCCATTAACGATCGCTGCCGTTTACCGAAGCACCGAGCTTTTGCTAGAGGCTTCCGCTGATCCAGATCTAATCGTAGGCATCGACTACAAACCGGTGGATCTGATTGCTCGTGGCATCAAATCTTCCAAACGGAAAGCTTTGGAGATGTTATTGAGGGGTTTTTCTGTAGAAGAAACCGAAGA...

Protein

Download Protein FASTA

104 aa · LXL04_024145|LXL04_024145|OH1004|PROTEIN

MNLDEVSFWYGRRNGCKGKMGFEERTPLTIAAVYRSTELLLEASADPDLIVGIDYKPVDLIARGIKSSKRKALEMLLRGFSVEETEETDTETISSKSNQQTNQE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024145`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024145

Location Chr05:82286758-82287195 (+)

Description Similar to At2g40140: Zinc finger CCCH domain-containing protein 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40140`	Involved in salt stress response.	No verified direct reference in this release
`At5g58620`	Zinc finger CCCH domain-containing protein 66.	No verified direct reference in this release
`At3g55980`	Involved in salt stress response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024145 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G40140

ath:AT3G55980

ath:AT5G58620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.577

Rank 1 · LXL04_024145 · OH-1004

Cytoplasm0.444

Rank 2 · LXL04_024145 · OH-1004

Mitochondrion0.058

Rank 3 · LXL04_024145 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_024145 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_024145 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XEE6`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 29	35.772%	Swiss-Prot	moderate database homology
`Q9LUZ4`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 66	33.607%	Swiss-Prot	moderate database homology
`Q93ZS9`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 47	57.500%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card