LXL04_024138 | RubberDandelionOmics

Gene overview

LXL04_024138

Reference: OH-1004 Chr: Chr05 Coordinates: 82161547-82163150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1227 bp · LXL04_024138|LXL04_024138|OH1004|cDNA

ATGGGGTTGAACGCGACTACACTGGTGTCAGGGAACGCTAAAGATGAGAACGCTCTTGCCGCCCAATATCAACTAATGAACTACATGTCCACACACATGTTTGTACGTAGATTGGTGTCTCAAAAACGAAGGCGTTTGTTGGTTGGTGGTTATGACCTTGACATGTCATACATCACTGACCGTATATTAGCCATGTCATTTCCCGCAGAACGAATGAGAGCCATATATCGAAATCCAATGTGGCAAGTCAAAGAAGTTTT...

CDS

Download CDS FASTA

1227 bp · LXL04_024138|LXL04_024138|OH1004|CDS

ATGGGGTTGAACGCGACTACACTGGTGTCAGGGAACGCTAAAGATGAGAACGCTCTTGCCGCCCAATATCAACTAATGAACTACATGTCCACACACATGTTTGTACGTAGATTGGTGTCTCAAAAACGAAGGCGTTTGTTGGTTGGTGGTTATGACCTTGACATGTCATACATCACTGACCGTATATTAGCCATGTCATTTCCCGCAGAACGAATGAGAGCCATATATCGAAATCCAATGTGGCAAGTCAAAGAAGTTTT...

Protein

Download Protein FASTA

408 aa · LXL04_024138|LXL04_024138|OH1004|PROTEIN

MGLNATTLVSGNAKDENALAAQYQLMNYMSTHMFVRRLVSQKRRRLLVGGYDLDMSYITDRILAMSFPAERMRAIYRNPMWQVKEVLEMRHSGHYKVFNLCIEQDYDPSHFNDRVERFPFDDNHVPPLPLIKEFCESVHSWLSSDPKNIVVIHCMAGKGRTGLMVSSYLVYSGLLAEEALQVYADKRTTNNLGVTIPSQRRYVNYWQKSLSFPEGCLPEVNIPKPSNREFLQIRLHDAKSLETVFFVVSEMQEVSGQRYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024138`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024138

Location Chr05:82161547-82163150 (-)

Description Similar to PTEN1: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39400`	Protein tyrosine phosphatase that also exhibits lipid phosphatase activity.	A tumor suppressor homolog, AtPTEN1, is essential for pollen development in Arabidopsis.2002 · DOI: 10.1105/tpc.005702

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0007056 spindle assembly involved in female meiosis Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009555 pollen development Biological Process

GO:0010467 gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016477 cell migration Biological Process

KEGG gene cross-reference

ath:AT5G39400

cfa:403832

ddi:DDB_G0286557

hsa:5728

mmu:19211

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · LXL04_024138 · OH-1004

Nucleus0.290

Rank 2 · LXL04_024138 · OH-1004

Cell membrane0.182

Rank 3 · LXL04_024138 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_024138 · OH-1004

Golgi apparatus0.110

Rank 5 · LXL04_024138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22784.2PTP-SAK97-180 aa

PF22785.2Tc-R-P115-173 aa

PF10409.16PTEN_C2289-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024138	`PF22784.2`	PTP-SAK	97	180	4.8e-08	33.9
LXL04_024138	`PF22785.2`	Tc-R-P	115	173	7e-10	40.1
LXL04_024138	`PF10409.16`	PTEN_C2	289	366	1.6e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLZ5`	Arabidopsis thaliana	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1	57.644%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card