Gene Card
Gene overview
cDNA / CDS / Protein Sequences
468 bp · LXL04_024113|LXL04_024113|OH1004|cDNA
ATGTTCCCCAAAAACCACCGGAAAGCGCTAGCAGCAGGAATAGTTCCTCTGCTTGTCGATTTATTGAGATCTCCGTGTCAACATGAAGATATTTCAATAGATTCGCTATCAATGTTGGCCATTTTGACTCAGAAATCCGATGGGACAATGGCTATTCTGAGTTGTGGAGCTCTCCATGTTATCCTCGATGTTGTAGGTTTTACAACATTGCAGGCTACAAAAGAATATTTTTTTACATTGTTGCTTACAATGTGCACAAA...
468 bp · LXL04_024113|LXL04_024113|OH1004|CDS
ATGTTCCCCAAAAACCACCGGAAAGCGCTAGCAGCAGGAATAGTTCCTCTGCTTGTCGATTTATTGAGATCTCCGTGTCAACATGAAGATATTTCAATAGATTCGCTATCAATGTTGGCCATTTTGACTCAGAAATCCGATGGGACAATGGCTATTCTGAGTTGTGGAGCTCTCCATGTTATCCTCGATGTTGTAGGTTTTACAACATTGCAGGCTACAAAAGAATATTTTTTTACATTGTTGCTTACAATGTGCACAAA...
Protein
Download Protein FASTA155 aa · LXL04_024113|LXL04_024113|OH1004|PROTEIN
MFPKNHRKALAAGIVPLLVDLLRSPCQHEDISIDSLSMLAILTQKSDGTMAILSCGALHVILDVVGFTTLQATKEYFFTLLLTMCTNGEGDVLHVLVSNPTLMGTLYSLLTEAGSRASKKMSSLIRILHDFNVKNLISSGTRRLIHFHEQFIDVW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_024113 |
|---|---|
| TK1151 ID | TkA04G510220 |
| OH-1004 ID | LXL04_024113 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_024113 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:81360666-81361133 (+) | |||||||||
| Description | Similar to PUB19: U-box domain-containing protein 19 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process GO:0009877 nodulation Biological Process GO:0010029 regulation of seed germination Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0016567 protein ubiquitination Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G10560 ath:AT1G60190 mtr:11430446 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.