LXL04_024055 | RubberDandelionOmics

Gene overview

LXL04_024055

Reference: OH-1004 Chr: Chr05 Coordinates: 78995520-78998732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_024055|LXL04_024055|OH1004|cDNA

ATGAACAGCACCGTCACTCGGTTCATCATTCACCATCTACTACCTCCTAATGCTCCGAGCTTCACCAGAATTCACGTCCACTTCATATCACCTCCTCGTCGTCGGAGATTCGGCACAGTTGCCGTCTCCCATTCTCAAGAGGTTATCGACGAGAGGATGGTGGTGGTTGGTGGCGGTGCTGCTGGCATATATGGAGCAATTAGGGCTAAAACTTTAGCTCCCAATCTTAACGTTATTGTGATTGAAAAAGCAAAGCCCTT...

CDS

Download CDS FASTA

1452 bp · LXL04_024055|LXL04_024055|OH1004|CDS

ATGAACAGCACCGTCACTCGGTTCATCATTCACCATCTACTACCTCCTAATGCTCCGAGCTTCACCAGAATTCACGTCCACTTCATATCACCTCCTCGTCGTCGGAGATTCGGCACAGTTGCCGTCTCCCATTCTCAAGAGGTTATCGACGAGAGGATGGTGGTGGTTGGTGGCGGTGCTGCTGGCATATATGGAGCAATTAGGGCTAAAACTTTAGCTCCCAATCTTAACGTTATTGTGATTGAAAAAGCAAAGCCCTT...

Protein

Download Protein FASTA

483 aa · LXL04_024055|LXL04_024055|OH1004|PROTEIN

MNSTVTRFIIHHLLPPNAPSFTRIHVHFISPPRRRRFGTVAVSHSQEVIDERMVVVGGGAAGIYGAIRAKTLAPNLNVIVIEKAKPLAKVKISGGGRCNVTNGHCPDIKILADKYPRGSKEFRGSFFNVHSPSDTMSWFSDHGVKLKIEEDGRVFPVSDNSSSIIDCLLNEARQKGVTLQTGKSVTSASISPSEKFILKIEKRTIDYVEFVEADYLLIASGSSQQGYNLANQLGHSIIKPVPSLFTFKIDDIQLTELSGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024055`
TK1151 ID	TkA06G183420
OH-1004 ID	LXL04_024055
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_024055`
Location	Chr05:78995520-78998732 (+)
Description	Similar to ytfP: Uncharacterized protein YtfP (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024055` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000154 rRNA modification Biological Process GO:0006364 rRNA processing Biological Process GO:0016042 lipid catabolic process Biological Process GO:0030573 bile acid catabolic process Biological Process GO:0005829 cytosol Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0106413 RNA dihydrouridine synthase activity Molecular Function
KEGG gene cross-reference	ag:EDS08212 bsu:BSU30060 ecj:JW3459 eco:b3492 ecoc:C3026_18915 hin:HI_0933 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.856

Rank 1 · LXL04_024055 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_024055 · OH-1004

Plastid0.068

Rank 3 · LXL04_024055 · OH-1004

Nucleus0.058

Rank 4 · LXL04_024055 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_024055 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03486.21HI0933_like52-464 aa

PF07992.21Pyr_redox_252-225 aa

PF22780.2HI0933_like_1st241-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024055	`PF03486.21`	HI0933_like	52	464	1.4e-66	225.2
LXL04_024055	`PF07992.21`	Pyr_redox_2	52	225	5.1e-07	30.1
LXL04_024055	`PF22780.2`	HI0933_like_1st	241	411	1.1e-35	123.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card