LXL04_024031 | RubberDandelionOmics

Gene overview

LXL04_024031

Reference: OH-1004 Chr: Chr05 Coordinates: 78221271-78226392 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2697 bp · LXL04_024031|LXL04_024031|OH1004|cDNA

ATGGCGTCTGATCACCACCACCAACACCGTCCCAACCGCCTATCCCTCCCGCCACGCACCGCCATCCCAATCACCCCGTCGCGCCATTACCCTCCCTTCACTCCAACTCCTACCCCCTCCAAAAACCGCCACCGTCTGCCTTCCTTCACCGccacaaaaaacaaaaaaatctCTCCCTCATCCCTCTTCCTCCTCCTCTTCTCCCTCCGGTCCCTCTACTCTCTCCTCCCGTTCCTCCAATCGTCACCATCGTCGTTCTC...

CDS

Download CDS FASTA

2697 bp · LXL04_024031|LXL04_024031|OH1004|CDS

ATGGCGTCTGATCACCACCACCAACACCGTCCCAACCGCCTATCCCTCCCGCCACGCACCGCCATCCCAATCACCCCGTCGCGCCATTACCCTCCCTTCACTCCAACTCCTACCCCCTCCAAAAACCGCCACCGTCTGCCTTCCTTCACCGCCACAAAAAACAAAAAAATCTCTCCCTCATCCCTCTTCCTCCTCCTCTTCTCCCTCCGGTCCCTCTACTCTCTCCTCCCGTTCCTCCAATCGTCACCATCGTCGTTCTC...

Protein

Download Protein FASTA

898 aa · LXL04_024031|LXL04_024031|OH1004|PROTEIN

MASDHHHQHRPNRLSLPPRTAIPITPSRHYPPFTPTPTPSKNRHRLPSFTATKNKKISPSSLFLLLFSLRSLYSLLPFLQSSPSSFSIFPFAFLVSLLSFLLTLSFSLFKQKSIFTFHQSITKSQQRVLFAKSILLTIVFLIRFQALRYCGTAAMILAETSGYVASHFLTRQNRSYTHLDRVGSNKVRGFFSLFLGLLLLSISWDRIECFPFSFINLGKLGFSSFIIANREKCVRVWPMLLPFLSGFLSGYEQGSINWGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024031`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024031

Location Chr05:78221271-78226392 (+)

Description Similar to MTP12: Metal tolerance protein 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04620`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0422200`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024031 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0030001 metal ion transport Biological Process

GO:0071578 zinc ion import across plasma membrane Biological Process

GO:1904257 zinc ion import into Golgi lumen Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:1990674 Golgi cis cisterna membrane Cellular Component

KEGG gene cross-reference

ath:AT2G04620

bta:613851

dosa:Os08g0422200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.384

Rank 1 · LXL04_024031 · OH-1004

Golgi apparatus0.193

Rank 2 · LXL04_024031 · OH-1004

Cell membrane0.161

Rank 3 · LXL04_024031 · OH-1004

Nucleus0.148

Rank 4 · LXL04_024031 · OH-1004

Lysosome / Vacuole0.146

Rank 5 · LXL04_024031 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01545.27Cation_efflux413-685 aa

PF01929.24Ribosomal_L14e853-882 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024031	`PF01545.27`	Cation_efflux	413	685	3.5e-41	141.9
LXL04_024031	`PF01929.24`	Ribosomal_L14e	853	882	4.8e-08	34.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI03`	Arabidopsis thaliana	Metal tolerance protein 12	81.507%	Swiss-Prot	weak database homology
`Q8H329`	Oryza sativa subsp. japonica	Metal tolerance protein 8	69.886%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card