Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1161 bp · LXL04_023910|LXL04_023910|OH1004|cDNA
ATGGGACTCTGGGAGAGATCGAAGGTAAGACGGTTATGTAACGAAATCATGAATCCATcagaagaagaaagaatgGAAGGAAATGGACCACCACCGGCGACAATCATTGAGCACAAGGCATATGCTCGAATCGGACTACTCGGCAATCCAAGCGACGTGTATCACGGGCGTACGATCTCCTTAAACATCTCGAACTTTTGGGCCTCTGTTCGTTTGGAACCGTCTTCAGATCTCAAGATCGTCCCTCACCCTACTCACGA...
1161 bp · LXL04_023910|LXL04_023910|OH1004|CDS
ATGGGACTCTGGGAGAGATCGAAGGTAAGACGGTTATGTAACGAAATCATGAATCCATCAGAAGAAGAAAGAATGGAAGGAAATGGACCACCACCGGCGACAATCATTGAGCACAAGGCATATGCTCGAATCGGACTACTCGGCAATCCAAGCGACGTGTATCACGGGCGTACGATCTCCTTAAACATCTCGAACTTTTGGGCCTCTGTTCGTTTGGAACCGTCTTCAGATCTCAAGATCGTCCCTCACCCTACTCACGA...
Protein
Download Protein FASTA386 aa · LXL04_023910|LXL04_023910|OH1004|PROTEIN
MGLWERSKVRRLCNEIMNPSEEERMEGNGPPPATIIEHKAYARIGLLGNPSDVYHGRTISLNISNFWASVRLEPSSDLKIVPHPTHDLVKFTSLSHLVNRLENEGYYGGVRLLMATCKVFTKYCKEQGINLHNNNFSLSYETNIPRQTGLSGSSAIVCAAFSCLVDFYKVRDKIDVEIRPQLILNAEKELGIVAGLQDRVAQVYGGLVYMDFEKSKMDECGHGIYTQLDTSLLPPLHLIYAENPSDSGKVHSTVRQRWLD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023910 |
|---|---|
| TK1151 ID | TkA06G196710 |
| OH-1004 ID | LXL04_023910 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 98.652 / OH-1004 94.819Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023910 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:73573745-73575888 (-) | |||||||||
| Description | Similar to GLCAK1: Glucuronokinase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006020 inositol metabolic process Biological Process GO:0042546 cell wall biogenesis Biological Process GO:0048868 pollen tube development Biological Process GO:0120218 host interaction involved in quorum sensing Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0008266 poly(U) RNA binding Molecular Function GO:0046872 metal ion binding Molecular Function GO:0047940 glucuronokinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G01640 ath:AT5G14470 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00288.33GHMP_kinases_N120-206 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_023910 | PF00288.33 | GHMP_kinases_N | 120 | 206 | 1.8e-09 | 38.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.