LXL04_023881 | RubberDandelionOmics

Gene overview

LXL04_023881

Reference: OH-1004 Chr: Chr05 Coordinates: 72284236-72286592 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1561 bp · LXL04_023881|LXL04_023881|OH1004|cDNA

AACTCTACAAACACGTGGACCTAAACGTCTAAAACCCTTGCTGCTTTTTTGGAGAGGAAATACTGCACTACTTTCTCGTTGTGTTCCCTCATCAATGGCGGCGGCTTCTTCTTCTTTGTCTAACCTTCAATTTCAATCACTTTCTTTCGCTAAAACCCTAAATCAGTCATCAAAGCCGATCACTCCCAAAAACTTAATTTCTTATAAACCCTGTTCCAGAACACTAGCTATCCGAGCCGTCATATCGCAAAACCCTACAG...

CDS

Download CDS FASTA

1524 bp · LXL04_023881|LXL04_023881|OH1004|CDS

TTGCTGCTTTTTTGGAGAGGAAATACTGCACTACTTTCTCGTTGTGTTCCCTCATCAATGGCGGCGGCTTCTTCTTCTTTGTCTAACCTTCAATTTCAATCACTTTCTTTCGCTAAAACCCTAAATCAGTCATCAAAGCCGATCACTCCCAAAAACTTAATTTCTTATAAACCCTGTTCCAGAACACTAGCTATCCGAGCCGTCATATCGCAAAACCCTACAGAAACCCAGACATTTCAGCATTGCTTCACCAAGAAAGA...

Protein

Download Protein FASTA

507 aa · LXL04_023881|LXL04_023881|OH1004|PROTEIN

MLLFWRGNTALLSRCVPSSMAAASSSLSNLQFQSLSFAKTLNQSSKPITPKNLISYKPCSRTLAIRAVISQNPTETQTFQHCFTKKDDGYLYCEGLKVQEVMEAVERRPFYLYSKPQITRNVEAYKDALEGLNSIIGYAIKANNNFPILQHLKNLGCGAVLVSGNELRLAIRAGFDPTRCIFNGNGKLLDDLVLAAQEGVFVNIDSEFDLDNIVSAAKIAGKKVNVLLRINPDVDPQVHPYVATGNKNSKFGIRNEKLQW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023881`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023881

Location Chr05:72284236-72286592 (+)

Description Similar to LYSA1: Diaminopimelate decarboxylase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14390`	Specifically catalyzes the decarboxylation of meso-diaminopimelate (meso-DAP) to L-lysine.	No verified direct reference in this release
`At5g11880`	Specifically catalyzes the decarboxylation of meso-diaminopimelate (meso-DAP) to L-lysine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0440000`	Specifically catalyzes the decarboxylation of meso-diaminopimelate (meso-DAP) to L-lysine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023881 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008836 diaminopimelate decarboxylase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

KEGG gene cross-reference

ath:AT3G14390

ath:AT5G11880

dosa:Os02g0440000

nme:NMB1976

pae:PA5277

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.944

Rank 1 · LXL04_023881 · OH-1004

Mitochondrion0.075

Rank 2 · LXL04_023881 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_023881 · OH-1004

Peroxisome0.038

Rank 4 · LXL04_023881 · OH-1004

Nucleus0.023

Rank 5 · LXL04_023881 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00278.29Orn_DAP_Arg_deC112-449 aa

PF02784.23Orn_Arg_deC_N117-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023881	`PF00278.29`	Orn_DAP_Arg_deC	112	449	5.7e-20	72.1
LXL04_023881	`PF02784.23`	Orn_Arg_deC_N	117	363	2.4e-48	165.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949X7`	Arabidopsis thaliana	Diaminopimelate decarboxylase 1, chloroplastic	75.862%	Swiss-Prot	strong database homology
`Q94A94`	Arabidopsis thaliana	Diaminopimelate decarboxylase 2, chloroplastic	74.850%	Swiss-Prot	strong database homology
`Q6ZG77`	Oryza sativa subsp. japonica	Probable diaminopimelate decarboxylase, chloroplastic	77.336%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card