LXL04_023562 | RubberDandelionOmics

Gene overview

LXL04_023562

Reference: OH-1004 Chr: Chr05 Coordinates: 50622771-50624835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_023562|LXL04_023562|OH1004|cDNA

ATGATGACAAAACTAGGGCTTGGAGGTCAAAAAATCTATGTGAGCAGTTGTTGGATTCAAAAGCTTTTAAACACTTCCCTCATGAAACTTACAACTATATGTCCACAGAAAATTTCGGTTGACATCAATCAAGCTTCAGCAACACTTGATCTACTGAATAAGATGATAAAGTATTACAGAGATGTTCAAGTCGTTCATACTGATGTCACCGTAAATGAAATTGCTAACTTTGAAGAAATCAGAAATTGTTTATGTTTACT...

CDS

Download CDS FASTA

1104 bp · LXL04_023562|LXL04_023562|OH1004|CDS

ATGATGACAAAACTAGGGCTTGGAGGTCAAAAAATCTATGTGAGCAGTTGTTGGATTCAAAAGCTTTTAAACACTTCCCTCATGAAACTTACAACTATATGTCCACAGAAAATTTCGGTTGACATCAATCAAGCTTCAGCAACACTTGATCTACTGAATAAGATGATAAAGTATTACAGAGATGTTCAAGTCGTTCATACTGATGTCACCGTAAATGAAATTGCTAACTTTGAAGAAATCAGAAATTGTTTATGTTTACT...

Protein

Download Protein FASTA

367 aa · LXL04_023562|LXL04_023562|OH1004|PROTEIN

MMTKLGLGGQKIYVSSCWIQKLLNTSLMKLTTICPQKISVDINQASATLDLLNKMIKYYRDVQVVHTDVTVNEIANFEEIRNCLCLLHQKWCTIFTWQDGPLIEAMKNGDMFLVDEISLADDSYLAEKGGSDLEKITAHPNFFILATMNPGGDYGKKELSPALRNRFTEIWVPPVNELMELKSIAVEKISNQEISFVVDAMINFWEWFNRLQTGRLLTESKLRLNQTDILTAENYDWYDILKSAEILSSNDMEIDTQFGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023562`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023562

Location Chr05:50622771-50624835 (+)

Description Similar to MDN1: Midasin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67120`	Nuclear chaperone required for maturation and nuclear export of pre-60S ribosome subunits.	The MIDASIN and NOTCHLESS genes are essential for female gametophyte development in Arabidopsis thaliana.2010 · DOI: 10.1007/s12298-010-0005-y The Mutation of Glu at Amino Acid 3838 of AtMDN1 Provokes Pleiotropic Developmental Phenotypes in Arabidopsis.2016 · DOI: 10.1038/srep36446

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023562 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0120330 rixosome complex Cellular Component

KEGG gene cross-reference

ath:AT1G67120

spo:2539491

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433

Rank 1 · LXL04_023562 · OH-1004

Nucleus0.394

Rank 2 · LXL04_023562 · OH-1004

Mitochondrion0.168

Rank 3 · LXL04_023562 · OH-1004

Peroxisome0.064

Rank 4 · LXL04_023562 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_023562 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07728.21AAA_596-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023562	`PF07728.21`	AAA_5	96	167	7.2e-12	46.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8AUY4`	Arabidopsis thaliana	Midasin	53.571%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card