LXL04_023493 | RubberDandelionOmics

Gene overview

LXL04_023493

Reference: OH-1004 Chr: Chr05 Coordinates: 45275829-45276177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

276 bp · LXL04_023493|LXL04_023493|OH1004|cDNA

ATGATTGTTGTAAGAAAAGTATACCGAAAAGCTTTTGTGACTCCTACACATCATGTCGAACAACATTGGAGAGACTATGAGAATTCAGTCAGCAGCGCTTTGGAAAAAGGATTGGTATCTGAGTATCAACCAAAATATAACAATGCAAGAGCTGTTTATAGAGAGAGGAAAAAGTGTGTTGATGAAATTGATTGGAATTTGGTTGTTGTGCCACCTTCTAGTTCTATTAAGgcaatttattttatttattttattttttt...

CDS

Download CDS FASTA

276 bp · LXL04_023493|LXL04_023493|OH1004|CDS

ATGATTGTTGTAAGAAAAGTATACCGAAAAGCTTTTGTGACTCCTACACATCATGTCGAACAACATTGGAGAGACTATGAGAATTCAGTCAGCAGCGCTTTGGAAAAAGGATTGGTATCTGAGTATCAACCAAAATATAACAATGCAAGAGCTGTTTATAGAGAGAGGAAAAAGTGTGTTGATGAAATTGATTGGAATTTGGTTGTTGTGCCACCTTCTAGTTCTATTAAGGCAATTTATTTTATTTATTTTATTTTTTT...

Protein

Download Protein FASTA

91 aa · LXL04_023493|LXL04_023493|OH1004|PROTEIN

MIVVRKVYRKAFVTPTHHVEQHWRDYENSVSSALEKGLVSEYQPKYNNARAVYRERKKCVDEIDWNLVVVPPSSSIKAIYFIYFIFLYFLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023493`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023493

Location Chr05:45275829-45276177 (-)

Description Similar to CSTF77: Cleavage stimulation factor subunit 77

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17760`	One of the multiple factors required for polyadenylation and 3'-end cleavage of pre-mRNAs (By similarity).	Targeted 3' processing of antisense transcripts triggers Arabidopsis FLC chromatin silencing.2010 · DOI: 10.1126/science.1180278

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0016441 post-transcriptional gene silencing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0031440 regulation of mRNA 3'-end processing Biological Process

GO:0042868 antisense RNA metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G17760

hsa:1479

mmu:228410

pon:100174283

spo:2541600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · LXL04_023493 · OH-1004

Nucleus0.356

Rank 2 · LXL04_023493 · OH-1004

Mitochondrion0.205

Rank 3 · LXL04_023493 · OH-1004

Endoplasmic reticulum0.086

Rank 4 · LXL04_023493 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_023493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05843.21Suf3-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023493	`PF05843.21`	Suf	3	75	1.4e-15	57.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUP1`	Arabidopsis thaliana	Cleavage stimulation factor subunit 77	62.025%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card