Gene Card
Gene overview
cDNA / CDS / Protein Sequences
603 bp · LXL04_023467|LXL04_023467|OH1004|cDNA
ATGCTAATGGCGCGATTCCCATCTTCCACGCTTGCACAGCCTCCGATTCCATTTCAAATTGCTATCGATTCATACAAATCGATTCATATAAAATCGGATCGGTTCACGCTTTTGGAACTGCAATTACATCGTCGCCCTCTACCCTCCCTTTTCCTCATCTTCTCCATCTTCTCCCTGCCGCTAAACCCTTGGAATGGAGGCAACAAGATCGGGCTAAGAAAGATGGACACCGAGCTGTGCGGAAAAGGTGAATCGCGACT...
603 bp · LXL04_023467|LXL04_023467|OH1004|CDS
ATGCTAATGGCGCGATTCCCATCTTCCACGCTTGCACAGCCTCCGATTCCATTTCAAATTGCTATCGATTCATACAAATCGATTCATATAAAATCGGATCGGTTCACGCTTTTGGAACTGCAATTACATCGTCGCCCTCTACCCTCCCTTTTCCTCATCTTCTCCATCTTCTCCCTGCCGCTAAACCCTTGGAATGGAGGCAACAAGATCGGGCTAAGAAAGATGGACACCGAGCTGTGCGGAAAAGGTGAATCGCGACT...
Protein
Download Protein FASTA200 aa · LXL04_023467|LXL04_023467|OH1004|PROTEIN
MLMARFPSSTLAQPPIPFQIAIDSYKSIHIKSDRFTLLELQLHRRPLPSLFLIFSIFSLPLNPWNGGNKIGLRKMDTELCGKGESRLPPDFDTVDERLQREGESAGSDWTTPSPSSRSHPPSPPSEKNQNGGNLVFLQNSTHYMFPIYNQITAFSDRHAEFEKLNTEILGVSVDNQRTISPPSYLKQTLAVNFSIARWNF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023467 |
|---|---|
| TK1151 ID | TkA05G137850 |
| OH-1004 ID | LXL04_023467 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 54.800 |
| Protein coverage (%) | TK1151 51.875 / OH-1004 41.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023467 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:42943506-42944183 (-) | ||||||||||||
| Description | Similar to BAS1: 2-Cys peroxiredoxin BAS1, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0009409 response to cold Biological Process GO:0033554 cellular response to stress Biological Process GO:0042744 hydrogen peroxide catabolic process Biological Process GO:0045454 cell redox homeostasis Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009579 thylakoid Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0010319 stromule Cellular Component GO:0048046 apoplast Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G11630 dosa:Os02g0537700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.