LXL04_023466 | RubberDandelionOmics

Gene overview

LXL04_023466

Reference: OH-1004 Chr: Chr05 Coordinates: 42941647-42942967 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · LXL04_023466|LXL04_023466|OH1004|cDNA

ATGGTTAGTTGTTTGTTCTCAGACTCATTCCCACTTCAAATTGCTTCTTCTCTTATAATCCATTTAATTGACAAAAATATGTTTGATATCATGAAGTCAAGGAATAAAGGGCAGTTTGGTAATTCTGCTGTTTGGAAATGGATGCATATTTGGAGGCCTTTTGCTTCTTTCATTCTGCTGCAGCTTTGTAAGAAGATTGGTCATAAGAAACTGCCGTGGCTGAAATATGACATGAAGAAGGCGGAGTATCTTGAAGCTAA...

CDS

Download CDS FASTA

660 bp · LXL04_023466|LXL04_023466|OH1004|CDS

ATGGTTAGTTGTTTGTTCTCAGACTCATTCCCACTTCAAATTGCTTCTTCTCTTATAATCCATTTAATTGACAAAAATATGTTTGATATCATGAAGTCAAGGAATAAAGGGCAGTTTGGTAATTCTGCTGTTTGGAAATGGATGCATATTTGGAGGCCTTTTGCTTCTTTCATTCTGCTGCAGCTTTGTAAGAAGATTGGTCATAAGAAACTGCCGTGGCTGAAATATGACATGAAGAAGGCGGAGTATCTTGAAGCTAA...

Protein

Download Protein FASTA

219 aa · LXL04_023466|LXL04_023466|OH1004|PROTEIN

MVSCLFSDSFPLQIASSLIIHLIDKNMFDIMKSRNKGQFGNSAVWKWMHIWRPFASFILLQLCKKIGHKKLPWLKYDMKKAEYLEAKELEKDAKKKLDEAAKMLNELKEPIENQKQEKKGHGLKCRRYRDLLDNTDTSHKQMIEKGNQLGAKVKGKYSDMDELEKQEQSRQERIGKAEKDLADTEMQLENLPVFQPPKDKIVIYASFTYFILFFLQLFH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023466`
TK1151 ID	TkA06G324230
OH-1004 ID	LXL04_023466
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 75.566 / OH-1004 76.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023466

Location Chr05:42941647-42942967 (-)

Description Similar to SMC5: Structural maintenance of chromosomes protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15920`	Core component of the SMC5-SMC6 complex that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids.	The STRUCTURAL MAINTENANCE OF CHROMOSOMES 5/6 complex promotes sister chromatid alignment and homologous recombination after DNA damage in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.060525

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023466 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0030915 Smc5-Smc6 complex Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G15920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.422

Rank 1 · LXL04_023466 · OH-1004

Nucleus0.317

Rank 2 · LXL04_023466 · OH-1004

Mitochondrion0.187

Rank 3 · LXL04_023466 · OH-1004

Endoplasmic reticulum0.098

Rank 4 · LXL04_023466 · OH-1004

Cell membrane0.091

Rank 5 · LXL04_023466 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFS8`	Arabidopsis thaliana	Structural maintenance of chromosomes protein 5	51.880%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card