LXL04_023439 | RubberDandelionOmics

Gene overview

LXL04_023439

Reference: OH-1004 Chr: Chr05 Coordinates: 41066488-41068301 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · LXL04_023439|LXL04_023439|OH1004|cDNA

ATGGCTGGGTTGCTGGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGCCGAGACCACCATCTAGCCGACgatttcttttcttctccttcaTGGTGCGATAACCTCCAAGCCACAACCGAACATCCAGCAGATTCAAATGAACCGGCACCTATTGACTTGGAGTACTACAGAAAAGGACTTAGATCTCACATAGTTCATTCCTACAAAGATTATTATGACAGTGTTGAAATCCCCAAGTTTGTAGACAAGAC...

CDS

Download CDS FASTA

657 bp · LXL04_023439|LXL04_023439|OH1004|CDS

ATGGCTGGGTTGCTGGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGCCGAGACCACCATCTAGCCGACGATTTCTTTTCTTCTCCTTCATGGTGCGATAACCTCCAAGCCACAACCGAACATCCAGCAGATTCAAATGAACCGGCACCTATTGACTTGGAGTACTACAGAAAAGGACTTAGATCTCACATAGTTCATTCCTACAAAGATTATTATGACAGTGTTGAAATCCCCAAGTTTGTAGACAAGAC...

Protein

Download Protein FASTA

218 aa · LXL04_023439|LXL04_023439|OH1004|PROTEIN

MAGLLGCRRGWFFLLVGHRRDHHLADDFFSSPSWCDNLQATTEHPADSNEPAPIDLEYYRKGLRSHIVHSYKDYYDSVEIPKFVDKTTPEYKPKFDALMTVTMTADEYFEKHPELKMKFDDEIRNDYWKKLGGLRGYAVGAEGRNVSDARSLKIEGVKDIIAVASGKGGVGKSTTAVNLAVSLANKCQLSVGLLDADGYFGHIWVFSAITPAIMGCAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023439`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023439

Location Chr05:41066488-41068301 (-)

Description Similar to At3g52300: ATP synthase subunit d, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52300`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release
`At4g19540`	Essential during early vegetative growth.	The evolutionarily conserved iron-sulfur protein INDH is required for complex I assembly and mitochondrial translation in Arabidopsis [corrected].2013 · DOI: 10.1105/tpc.113.117283

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023439 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G52300

ath:AT4G19540

ddi:DDB_G0291193

dme:Dmel_CG3262

hpj:jhp_0193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.629

Rank 1 · LXL04_023439 · OH-1004

Cytoplasm0.158

Rank 2 · LXL04_023439 · OH-1004

Plastid0.114

Rank 3 · LXL04_023439 · OH-1004

Nucleus0.108

Rank 4 · LXL04_023439 · OH-1004

Peroxisome0.049

Rank 5 · LXL04_023439 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10609.16ParA157-197 aa

PF13614.13AAA_31159-197 aa

PF01656.30CbiA161-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023439	`PF10609.16`	ParA	157	197	1.9e-13	51.2
LXL04_023439	`PF13614.13`	AAA_31	159	197	1.3e-07	32.4
LXL04_023439	`PF01656.30`	CbiA	161	197	5.3e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT52`	Arabidopsis thaliana	ATP synthase subunit d, mitochondrial	54.955%	Swiss-Prot	weak database homology
`O49472`	Arabidopsis thaliana	Iron-sulfur protein required for NADH dehydrogenase, mitochondrial	67.797%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card