LXL04_023437 | RubberDandelionOmics

Gene overview

LXL04_023437

Reference: OH-1004 Chr: Chr05 Coordinates: 40890359-40895716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · LXL04_023437|LXL04_023437|OH1004|cDNA

ATGAGCATACGAAAAACAGGGGAACCGGTTGATTGTTGTTTTTTATCGAACTTTCCGTTAGCCATTCTCGTCATTGTTTCTGGTGATGCTGATGGGTCACTTGGTCAATTGATCTATTTGTTCGTGAATGGTGTAATGTTTGTCGAAATAATTGGTTTTCCGAGAAGGAGAAAGGAACAGGGGAACTGGTTGGTTCCCCCGTTGATGTTCGTGGATGGGAAACCTCTATCTGAAGCGATGAAGTATGTCCTTGTGACTGG...

CDS

Download CDS FASTA

2007 bp · LXL04_023437|LXL04_023437|OH1004|CDS

ATGAGCATACGAAAAACAGGGGAACCGGTTGATTGTTGTTTTTTATCGAACTTTCCGTTAGCCATTCTCGTCATTGTTTCTGGTGATGCTGATGGGTCACTTGGTCAATTGATCTATTTGTTCGTGAATGGTGTAATGTTTGTCGAAATAATTGGTTTTCCGAGAAGGAGAAAGGAACAGGGGAACTGGTTGGTTCCCCCGTTGATGTTCGTGGATGGGAAACCTCTATCTGAAGCGATGAAGTATGTCCTTGTGACTGG...

Protein

Download Protein FASTA

668 aa · LXL04_023437|LXL04_023437|OH1004|PROTEIN

MSIRKTGEPVDCCFLSNFPLAILVIVSGDADGSLGQLIYLFVNGVMFVEIIGFPRRRKEQGNWLVPPLMFVDGKPLSEAMKYVLVTGGVVSGLGKGVTASSIGLLLQACGLRVTSIKIDPYLNKDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDVKLTRDNNITTGKIYQSVIDKERKGDYLGKTVQVVPHITDAIQDWIERVAAIPVDGKEGPPDVCVIELGGTIGDIESMPFIEALGQFSYRVGAGNFCLIHVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023437`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_023437`
Location	Chr05:40890359-40895716 (-)
Description	Similar to Ctps1: CTP synthase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023437` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006241 CTP biosynthetic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0019856 pyrimidine nucleobase biosynthetic process Biological Process GO:0032480 negative regulation of type I interferon production Biological Process GO:0044210 'de novo' CTP biosynthetic process Biological Process GO:0140861 DNA repair-dependent chromatin remodeling Biological Process GO:1902340 negative regulation of chromosome condensation Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0097268 cytoophidium Cellular Component
KEGG gene cross-reference	cge:100689101 ddi:DDB_G0280567 mmu:51797 xla:444477 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · LXL04_023437 · OH-1004

Nucleus0.300

Rank 2 · LXL04_023437 · OH-1004

Mitochondrion0.098

Rank 3 · LXL04_023437 · OH-1004

Peroxisome0.085

Rank 4 · LXL04_023437 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_023437 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06418.21CTP_synth_N81-351 aa

PF00117.35GATase389-622 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023437	`PF06418.21`	CTP_synth_N	81	351	1.1e-122	409.2
LXL04_023437	`PF00117.35`	GATase	389	622	1.6e-43	149.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card