LXL04_023386 | RubberDandelionOmics

Gene overview

LXL04_023386

Reference: OH-1004 Chr: Chr05 Coordinates: 37016771-37018058 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

867 bp · LXL04_023386|LXL04_023386|OH1004|cDNA

ATGGAGTCCCCATTCAAGGGAGATATACTGAAGGGGAAAGTGGGGTTGTTGACCGGCGGTGGATCTGGAATCGGATTTGAAATTGCTGCACAATTGGGGAAACATGGAGCTTCCATCGCGATCATGGGTCGTCGCAAACACGTCCTTGATTCCGCCGTTTCTGCTCTTCAATCCCTCGGCATTCACGCTATTGCGATTGAAGGAGATGTTCGGAAGAGAGAGGACGCTGCTCAAGCTATAGACACAACGATCAAGCAGTT...

CDS

Download CDS FASTA

867 bp · LXL04_023386|LXL04_023386|OH1004|CDS

ATGGAGTCCCCATTCAAGGGAGATATACTGAAGGGGAAAGTGGGGTTGTTGACCGGCGGTGGATCTGGAATCGGATTTGAAATTGCTGCACAATTGGGGAAACATGGAGCTTCCATCGCGATCATGGGTCGTCGCAAACACGTCCTTGATTCCGCCGTTTCTGCTCTTCAATCCCTCGGCATTCACGCTATTGCGATTGAAGGAGATGTTCGGAAGAGAGAGGACGCTGCTCAAGCTATAGACACAACGATCAAGCAGTT...

Protein

Download Protein FASTA

288 aa · LXL04_023386|LXL04_023386|OH1004|PROTEIN

MESPFKGDILKGKVGLLTGGGSGIGFEIAAQLGKHGASIAIMGRRKHVLDSAVSALQSLGIHAIAIEGDVRKREDAAQAIDTTIKQFGRLDILVNAAAGNFLVPSEDLSPNGFRTVIDIDAVGTFTMCHEALKYLKKGGIIINISATLHYTASWYQIHVSAAKAAVDSLTRSLALEWGTDYGIRVNGIAPGPIDDTTGITKLLPEEVRRKKQEESALYRMGKKWDIAMAALYLASDAGNYVNGTTLVVDGGIWLTSPRYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023386`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023386

Location Chr05:37016771-37018058 (+)

Description Similar to At3g12800: Peroxisomal 2,4-dienoyl-CoA reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12800`	Auxiliary enzyme of beta-oxidation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023386 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0009062 fatty acid catabolic process Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008670 2,4-dienoyl-CoA reductase (NADPH) activity Molecular Function

GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function

GO:0019166 trans-2-enoyl-CoA reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT3G12800

hsa:26063

mmu:26378

pon:100172330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.711

Rank 1 · LXL04_023386 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_023386 · OH-1004

Mitochondrion0.109

Rank 3 · LXL04_023386 · OH-1004

Nucleus0.096

Rank 4 · LXL04_023386 · OH-1004

Plastid0.039

Rank 5 · LXL04_023386 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short14-199 aa

PF23441.1SDR15-254 aa

PF08659.17KR16-172 aa

PF13561.13adh_short_C222-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023386	`PF00106.32`	adh_short	14	199	1.2e-42	146.3
LXL04_023386	`PF23441.1`	SDR	15	254	9.2e-09	35.8
LXL04_023386	`PF08659.17`	KR	16	172	3.3e-11	44.2
LXL04_023386	`PF13561.13`	adh_short_C2	22	252	2.8e-54	184.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTV6`	Arabidopsis thaliana	Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]	70.805%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card