LXL04_023368 | RubberDandelionOmics

Gene overview

LXL04_023368

Reference: OH-1004 Chr: Chr05 Coordinates: 35601369-35604479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3033 bp · LXL04_023368|LXL04_023368|OH1004|cDNA

ATGGCACCGCCACCATATATCCTCTCCTTCTTCGTCTTCATCTCCCTCACCTCCGTTATAAGTTCACAACAGTTCTTCACGTCCGACCAAACCACCTTGCTTAACCTCAAGCAATGGTGGGAAAATCCACCGTCACTAGCAAATTGGAACTCTACGTCATCACCTTGCAGCTGGCCGGAGGTTCAGTGCCGGAATGGCTCCGTCACCGTGCTGCAACTAGACAACATGGAACTTACCGGAACTATACCGCCGTTTATCTG...

CDS

Download CDS FASTA

3033 bp · LXL04_023368|LXL04_023368|OH1004|CDS

ATGGCACCGCCACCATATATCCTCTCCTTCTTCGTCTTCATCTCCCTCACCTCCGTTATAAGTTCACAACAGTTCTTCACGTCCGACCAAACCACCTTGCTTAACCTCAAGCAATGGTGGGAAAATCCACCGTCACTAGCAAATTGGAACTCTACGTCATCACCTTGCAGCTGGCCGGAGGTTCAGTGCCGGAATGGCTCCGTCACCGTGCTGCAACTAGACAACATGGAACTTACCGGAACTATACCGCCGTTTATCTG...

Protein

Download Protein FASTA

1010 aa · LXL04_023368|LXL04_023368|OH1004|PROTEIN

MAPPPYILSFFVFISLTSVISSQQFFTSDQTTLLNLKQWWENPPSLANWNSTSSPCSWPEVQCRNGSVTVLQLDNMELTGTIPPFICDLRNLENMILHDNYITGEFPRVFFNCSKLIELDISQNLFVGRLPEDIDRLSQLQSVEFGGNNFTGDIPPAIGNISALTSLQLYQNLFNGTIPPEIGNLSNLETLGLAYNEFADPVLPPEFGKLSSLQILWMAATNLVGNIPESLSNLASLRSLDLSLNYLEGEIPPGLFLLTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023368`
TK1151 ID	TkA06G351310
OH-1004 ID	LXL04_023368
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023368

Location Chr05:35601369-35604479 (+)

Description Similar to HSL1: Receptor-like protein kinase HSL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release
`At4g28490`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission.	No verified direct reference in this release
`At5g65710`	Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission.	No verified direct reference in this release
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023368 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048229 gametophyte development Biological Process

KEGG gene cross-reference

ath:AT1G28440

ath:AT4G28490

ath:AT5G65700

ath:AT5G65710

gmx:732625

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874

Rank 1 · LXL04_023368 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_023368 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_023368 · OH-1004

Nucleus0.038

Rank 4 · LXL04_023368 · OH-1004

Lysosome / Vacuole0.027

Rank 5 · LXL04_023368 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_890-149 aa

PF23598.2LRR_14158-271 aa

PF13855.13LRR_8283-341 aa

PF13855.13LRR_8514-556 aa

PF12799.14LRR_4521-560 aa

PF00069.32Pkinase686-963 aa

PF07714.24PK_Tyr_Ser-Thr688-965 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023368	`PF13855.13`	LRR_8	90	149	3e-30	104.5
LXL04_023368	`PF23598.2`	LRR_14	158	271	1.8e-24	86.9
LXL04_023368	`PF13855.13`	LRR_8	283	341	3e-30	104.5
LXL04_023368	`PF13855.13`	LRR_8	514	556	3e-30	104.5
LXL04_023368	`PF12799.14`	LRR_4	521	560	3.7e-24	84.9
LXL04_023368	`PF00069.32`	Pkinase	686	963	6.7e-43	147.7
LXL04_023368	`PF07714.24`	PK_Tyr_Ser-Thr	688	965	1.4e-36	126.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGP2`	Arabidopsis thaliana	Receptor-like protein kinase HSL1	42.813%	Swiss-Prot	moderate database homology
`P47735`	Arabidopsis thaliana	Receptor-like protein kinase 5	42.474%	Swiss-Prot	moderate database homology
`C0LGX3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase HSL2	39.917%	Swiss-Prot	moderate database homology
`O49545`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	38.503%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card