LXL04_023356 | RubberDandelionOmics

Gene overview

LXL04_023356

Reference: OH-1004 Chr: Chr05 Coordinates: 35033397-35034980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_023356|LXL04_023356|OH1004|cDNA

ATGATGACATTAGGGTTCCGCCATTGTCGCCGCTTTTGGTTTCCGGCGAACCGTCTCCTCCATACAATCTTTCTCATTGTTATCTATGTCTCCAACAACCATCACCTCCCGGTCTATGGTGGCAGCCACCATGACCGGCGTGATCTTATGGAAGATGCTGGAGTCGATAGTACTGTCATTGATCCATCTCTTGATTTCGAAAATGTACGAATGAAAAATGCGTACATAGCATTACAAGCATGGAAATCAGTCATCGTATC...

CDS

Download CDS FASTA

1458 bp · LXL04_023356|LXL04_023356|OH1004|CDS

ATGATGACATTAGGGTTCCGCCATTGTCGCCGCTTTTGGTTTCCGGCGAACCGTCTCCTCCATACAATCTTTCTCATTGTTATCTATGTCTCCAACAACCATCACCTCCCGGTCTATGGTGGCAGCCACCATGACCGGCGTGATCTTATGGAAGATGCTGGAGTCGATAGTACTGTCATTGATCCATCTCTTGATTTCGAAAATGTACGAATGAAAAATGCGTACATAGCATTACAAGCATGGAAATCAGTCATCGTATC...

Protein

Download Protein FASTA

485 aa · LXL04_023356|LXL04_023356|OH1004|PROTEIN

MMTLGFRHCRRFWFPANRLLHTIFLIVIYVSNNHHLPVYGGSHHDRRDLMEDAGVDSTVIDPSLDFENVRMKNAYIALQAWKSVIVSDPHGVTDTWVGSEVCNYTGVFCYQSPDNPKERTVAGIDLNHQDLAGTLPNLLGLLFDLGLFHINSNRFCGRLPRSFLNLKILSELDLSNNRFAGKFPDFILELPNLKYLDIRFNEFEGKLPKKLFNKNLDAILINNNRFTSLIPEEIGNSPASVIVLANNKFGGCIPESITKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023356`
TK1151 ID	TkA06G355100
OH-1004 ID	LXL04_023356
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.800
Protein coverage (%)	TK1151 83.465 / OH-1004 21.856 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023356

Location Chr05:35033397-35034980 (+)

Description Similar to LRX4: Leucine-rich repeat extensin-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g18670`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At1g62440`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	Synergistic interaction of the two paralogous Arabidopsis genes LRX1 and LRX2 in cell wall formation during root hair development.2003 · DOI: 10.1046/j.1365-313x.2003.01784.x
`At5g25550`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023356 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

GO:0042277 peptide binding Molecular Function

KEGG gene cross-reference

ath:AT1G62440

ath:AT3G24480

ath:AT4G13340

ath:AT4G18670

ath:AT5G25550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.526

Rank 1 · LXL04_023356 · OH-1004

Extracellular0.157

Rank 2 · LXL04_023356 · OH-1004

Endoplasmic reticulum0.132

Rank 3 · LXL04_023356 · OH-1004

Cytoplasm0.077

Rank 4 · LXL04_023356 · OH-1004

Plastid0.073

Rank 5 · LXL04_023356 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8149-202 aa

PF12799.14LRR_4169-201 aa

PF13855.13LRR_8263-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023356	`PF13855.13`	LRR_8	149	202	5.4e-15	55.6
LXL04_023356	`PF12799.14`	LRR_4	169	201	7.2e-09	36.3
LXL04_023356	`PF13855.13`	LRR_8	263	321	5.4e-15	55.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0K5`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 3	62.373%	Swiss-Prot	moderate database homology
`Q9LHF1`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 4	63.103%	Swiss-Prot	moderate database homology
`Q9SN46`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 5	60.000%	Swiss-Prot	moderate database homology
`O48809`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 2	59.206%	Swiss-Prot	moderate database homology
`Q4PSE6`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 7	54.723%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card