LXL04_023247 | RubberDandelionOmics

Gene overview

LXL04_023247

Reference: OH-1004 Chr: Chr05 Coordinates: 28533464-28534615 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · LXL04_023247|LXL04_023247|OH1004|cDNA

ATGATGATCACTTCATGGGTAAACAGAGACATCTTCTATAAAAACCTCCTTATAGATATAGACGCTCCTTTCACATGGTATGATTGCATCGCGGACTGGAAAAGTTTGGTTGTAAACAAAGATTGCCCCACTTGCCCTGCCCCAGTTTCTTGTCAAGAATATGCATGCACGGATGTCCGTACATCTTACTCTTATGAAAGTCAATCATGTCTTCCCATAACCAACACTTCGACATTACCTGGTTGGGGAGAATGCACATG...

CDS

Download CDS FASTA

1152 bp · LXL04_023247|LXL04_023247|OH1004|CDS

ATGATGATCACTTCATGGGTAAACAGAGACATCTTCTATAAAAACCTCCTTATAGATATAGACGCTCCTTTCACATGGTATGATTGCATCGCGGACTGGAAAAGTTTGGTTGTAAACAAAGATTGCCCCACTTGCCCTGCCCCAGTTTCTTGTCAAGAATATGCATGCACGGATGTCCGTACATCTTACTCTTATGAAAGTCAATCATGTCTTCCCATAACCAACACTTCGACATTACCTGGTTGGGGAGAATGCACATG...

Protein

Download Protein FASTA

383 aa · LXL04_023247|LXL04_023247|OH1004|PROTEIN

MMITSWVNRDIFYKNLLIDIDAPFTWYDCIADWKSLVVNKDCPTCPAPVSCQEYACTDVRTSYSYESQSCLPITNTSTLPGWGECTCPVNVVNPVNRTCGQALLNYDEFTFAQSDSKNRFPEFLFRANPNAGCAPISMFDSFPENVTGVMAFSTSRYAFPAYLFQPFTKTLGICLPSLLSTQGVMFMGSGPYYLLPNSDVDIRSLLSYTPLLSHRDSFGYFIAVKEIVVKGRSIDVSNSSTKLSTIEPYTIMRTDIYKQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023247`
TK1151 ID	TkA06G374100
OH-1004 ID	LXL04_023247
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023247

Location Chr05:28533464-28534615 (-)

Description Similar to GIP2: Probable aspartic proteinase GIP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0937050`	Chitinase that possesses antifungal activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023247 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0006508 proteolysis Biological Process

GO:0006952 defense response Biological Process

GO:0043086 negative regulation of catalytic activity Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004857 enzyme inhibitor activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0937050

lang:109345795

osa:9267890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.373

Rank 1 · LXL04_023247 · OH-1004

Cell membrane0.207

Rank 2 · LXL04_023247 · OH-1004

Endoplasmic reticulum0.117

Rank 3 · LXL04_023247 · OH-1004

Lysosome / Vacuole0.109

Rank 4 · LXL04_023247 · OH-1004

Cytoplasm0.107

Rank 5 · LXL04_023247 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N15-189 aa

PF14541.12TAXi_C220-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023247	`PF14543.12`	TAXi_N	15	189	4.6e-15	57.0
LXL04_023247	`PF14541.12`	TAXi_C	220	365	2.2e-40	138.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S1V1`	Oryza sativa subsp. japonica	Chitinase CLP	31.714%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card