LXL04_023141 | RubberDandelionOmics

Gene overview

LXL04_023141

Reference: OH-1004 Chr: Chr05 Coordinates: 24501158-24506794 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2313 bp · LXL04_023141|LXL04_023141|OH1004|cDNA

ATGGCAGAAGTGATGGACACGCCGGTCGATGCAGTGGAACGTCGTAGTAGCCTAGAGCGCAAAGATGAGGACGGCGACGGCAATGGCAATGGAGACGGCGAAGACAATAACAAGTCCACCGTAATCGAAAACCCCGATGCTTCTTCTCCTCCACAACCGCCACCGCCTCGACGCAATGACCGTGATTCCAGAGAGAGAAGAAACGAAGACAGGGATCGGGACACTGATCGTCCACCTAATCGTCGTTCCGATTACTATGA...

CDS

Download CDS FASTA

2313 bp · LXL04_023141|LXL04_023141|OH1004|CDS

ATGGCAGAAGTGATGGACACGCCGGTCGATGCAGTGGAACGTCGTAGTAGCCTAGAGCGCAAAGATGAGGACGGCGACGGCAATGGCAATGGAGACGGCGAAGACAATAACAAGTCCACCGTAATCGAAAACCCCGATGCTTCTTCTCCTCCACAACCGCCACCGCCTCGACGCAATGACCGTGATTCCAGAGAGAGAAGAAACGAAGACAGGGATCGGGACACTGATCGTCCACCTAATCGTCGTTCCGATTACTATGA...

Protein

Download Protein FASTA

770 aa · LXL04_023141|LXL04_023141|OH1004|PROTEIN

MAEVMDTPVDAVERRSSLERKDEDGDGNGNGDGEDNNKSTVIENPDASSPPQPPPPRRNDRDSRERRNEDRDRDTDRPPNRRSDYYEHRNRSPSGPPPRDYKRRAGSPNSPPPPYRDRRGGGHSPPPRRSPPFPPFKRSRRDDGGYDGRRGSPRGGFGPGDRRFGYDHPGGYDRDMGGRPGYPDDRPRGRYGGRPSGGYQGGPSDWDSARGGYNDHGNTHREGLMSYKQFIQELEDDVLPSEAERRYQEYKSEYITTQKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023141`
TK1151 ID	TkA06G393660
OH-1004 ID	LXL04_023141
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023141

Location Chr05:24501158-24506794 (-)

Description Similar to SE: Serrate RNA effector molecule

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27100`	Acts as a mediator between the cap-binding complex (CBC) and both the pre-mRNA splicing and primary microRNAs (miRNAs) processing machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023141 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0031053 primary miRNA processing Biological Process

GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process

GO:0048367 shoot system development Biological Process

GO:0048509 regulation of meristem development Biological Process

GO:0097150 neuronal stem cell population maintenance Biological Process

GO:2000011 regulation of adaxial/abaxial pattern formation Biological Process

KEGG gene cross-reference

ath:AT2G27100

dgr:6560148

dvi:6624841

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_023141 · OH-1004

Cytoplasm0.170

Rank 2 · LXL04_023141 · OH-1004

Mitochondrion0.013

Rank 3 · LXL04_023141 · OH-1004

Cell membrane0.013

Rank 4 · LXL04_023141 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_023141 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12066.14SERRATE_Ars2_N228-309 aa

PF04959.20ARS2472-669 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023141	`PF12066.14`	SERRATE_Ars2_N	228	309	6e-21	75.4
LXL04_023141	`PF04959.20`	ARS2	472	669	5.6e-39	135.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVD0`	Arabidopsis thaliana	Serrate RNA effector molecule	66.049%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card